| Clone Name | rbaal33p06 |
|---|---|
| Clone Library Name | barley_pub |
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 32.7 bits (73), Expect = 0.26 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 238 AFKPPGCEESGKA 200 AFKPPGCEESGKA Sbjct: 101 AFKPPGCEESGKA 113
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 238 AFKPPGCEESGKA 200 AF+PPGCEESGKA Sbjct: 163 AFRPPGCEESGKA 175
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 238 AFKPPGCEESGKA 200 AFKPPGC+ESGKA Sbjct: 162 AFKPPGCQESGKA 174
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 31.6 bits (70), Expect = 0.57 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = -3 Query: 238 AFKPPGCEESGKA 200 AF+PPGCEESGKA Sbjct: 162 AFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 29.6 bits (65), Expect = 2.2 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = -3 Query: 238 AFKPPGCEESGKA 200 A KPPGCEESGKA Sbjct: 163 ASKPPGCEESGKA 175
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 28.5 bits (62), Expect = 4.8 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 77 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFICGPSXV 190 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193
>KRA43_HUMAN (Q9BYR4) Keratin-associated protein 4-3 (Keratin-associated protein| 4.3) (Ultrahigh sulfur keratin-associated protein 4.3) (Fragment) Length = 98 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 85 CVCPCSCTTHGSKKTCLYVKCC 20 C CP SC T + TC + CC Sbjct: 72 CRCPFSCPTTCCRTTCFHPICC 93
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 238 AFKPPGCEESG 206 A+KPPGCEESG Sbjct: 163 AYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 28.1 bits (61), Expect = 6.3 Identities = 10/11 (90%), Positives = 11/11 (100%) Frame = -3 Query: 238 AFKPPGCEESG 206 A+KPPGCEESG Sbjct: 163 AYKPPGCEESG 173 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,904,000 Number of Sequences: 219361 Number of extensions: 582756 Number of successful extensions: 1658 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1499 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1654 length of database: 80,573,946 effective HSP length: 55 effective length of database: 68,509,091 effective search space used: 1644218184 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)