| Clone Name | rbaal33n24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AKAP2_MOUSE (O54931) A-kinase anchor protein 2 (Protein kinase A... | 30 | 4.9 | 2 | MDH_BACIS (Q59202) Malate dehydrogenase (EC 1.1.1.37) | 30 | 6.5 |
|---|
>AKAP2_MOUSE (O54931) A-kinase anchor protein 2 (Protein kinase A-anchoring| protein 2) (PRKA2) (AKAP-2) (AKAP expressed in kidney and lung) (AKAP-KL) Length = 885 Score = 30.4 bits (67), Expect = 4.9 Identities = 20/64 (31%), Positives = 25/64 (39%) Frame = +1 Query: 199 HSSSVVSEIRRTSYRSSPPFPILASIPGPKKEVNFACLFSKSDSPNDLASNSSTKQYFPS 378 HS + + S R PP L+ IP + +D P DL NS PS Sbjct: 95 HSVTEAEPTEKASGRQVPPHIELSRIPSDRMAEGERANGHSTDQPQDLLGNSLQAPASPS 154 Query: 379 SVTS 390 S TS Sbjct: 155 SSTS 158
>MDH_BACIS (Q59202) Malate dehydrogenase (EC 1.1.1.37)| Length = 312 Score = 30.0 bits (66), Expect = 6.5 Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 1/89 (1%) Frame = -1 Query: 428 IPRRSAPILQKIQEVTDDGKYCLVLEFEAKSLGLSDFEKRQAKFTSFFGPGIEAKIGKGG 249 IP+ P K ++ + VL F+A +G S++E+ GI K G Sbjct: 37 IPQAENPTKGKALDMLESSP---VLGFDANIIGTSNYEETADSDIVVITAGIARKPGMSR 93 Query: 248 DDLYEV-RLISETTEEE*QRLRPDSLLLI 165 DDL + + + ++ +E + P+S++++ Sbjct: 94 DDLVQTNQKVMKSVTKEVVKYSPNSIIIV 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,165,615 Number of Sequences: 219361 Number of extensions: 1713157 Number of successful extensions: 4365 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4266 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4356 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)