| Clone Name | rbaal33n20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EPB42_HUMAN (P16452) Erythrocyte membrane protein band 4.2 (Eryt... | 29 | 8.1 |
|---|
>EPB42_HUMAN (P16452) Erythrocyte membrane protein band 4.2 (Erythrocyte protein| 4.2) (P4.2) Length = 690 Score = 28.9 bits (63), Expect = 8.1 Identities = 24/88 (27%), Positives = 36/88 (40%) Frame = -2 Query: 449 FQPRNPEDALAAFSVLSRSKIPGVVXXXXXXRIPDRKSWLVGLSDADAADAAERFSEQWP 270 F P + AL A + SKI + DRK W + + DA S P Sbjct: 51 FLPALKKVALTAQTGEQPSKINRTQATFPISSLGDRKWWSAVVEERDAQSWT--ISVTTP 108 Query: 269 TDLVVGNHDCRDYTNGLVEVLTGQKRVL 186 D V+G++ +G ++L GQ +L Sbjct: 109 ADAVIGHYSLLLQVSGRKQLLLGQFTLL 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,883,677 Number of Sequences: 219361 Number of extensions: 930215 Number of successful extensions: 2688 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2636 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2688 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)