| Clone Name | rbaal34c08 |
|---|---|
| Clone Library Name | barley_pub |
>PHT21_ARATH (Q38954) Inorganic phosphate transporter 2-1, chloroplast precursor| (H(+)/Pi cotransporter) (AtPht2;1) Length = 587 Score = 56.2 bits (134), Expect(2) = 9e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLILTKI 393 VRAETVREIV SW+VTIPVGA L+V+YT I TKI Sbjct: 549 VRAETVREIVASWLVTIPVGATLAVIYTWIFTKI 582 Score = 22.3 bits (46), Expect(2) = 9e-09 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 528 MGVGFAXGLN 499 MGVGFA GLN Sbjct: 538 MGVGFARGLN 547
>Y962_CHLTR (O84698) Putative phosphate permease CT_962| Length = 426 Score = 37.0 bits (84), Expect = 0.033 Identities = 13/31 (41%), Positives = 23/31 (74%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 + +++IV+SW +T+P GA LS+V+ L+L Sbjct: 391 INLRIIKDIVLSWFITVPAGAALSIVFFLLL 421
>Y064_CHLMU (Q9PLN5) Putative phosphate permease TC0064| Length = 426 Score = 36.6 bits (83), Expect = 0.044 Identities = 13/34 (38%), Positives = 24/34 (70%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLILTKI 393 + +++IV+SW VT+P GA LS+++ L+L + Sbjct: 391 INLRIIKDIVLSWFVTVPAGAALSIMFFLLLRAV 424
>Y680_CHLPN (Q9Z7M4) Putative phosphate permease| CPn_0680/CP0067/CPj0680/CpB0707 Length = 426 Score = 34.7 bits (78), Expect = 0.17 Identities = 12/31 (38%), Positives = 22/31 (70%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 + +++IV+SW +T+P GALLS+++ L Sbjct: 391 INLNIIKDIVLSWFITLPAGALLSILFFFAL 421
>Y2061_PYRKO (Q5JHX4) Putative phosphate permease TK2061| Length = 406 Score = 34.3 bits (77), Expect = 0.22 Identities = 14/31 (45%), Positives = 21/31 (67%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 + + VR+I++SW VT+PV AL+S IL Sbjct: 372 INKDIVRDIIISWFVTVPVAALISAFLFKIL 402
>Y1401_PYRAB (Q9UYV6) Putative phosphate permease PYRAB14010| Length = 405 Score = 33.5 bits (75), Expect = 0.37 Identities = 13/31 (41%), Positives = 20/31 (64%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 + VR+I++SW VT+PV L+S + IL Sbjct: 371 INKSIVRDIIISWFVTVPVAGLISAIIFKIL 401
>Y1604_HAEIN (P45268) Putative phosphate permease HI1604| Length = 420 Score = 32.0 bits (71), Expect = 1.1 Identities = 11/29 (37%), Positives = 19/29 (65%) Frame = -2 Query: 479 VREIVVSWVVTIPVGALLSVVYTLILTKI 393 +R I+ SW+VT+P GA +++ +L I Sbjct: 390 IRNIISSWIVTLPAGAFFAIIIFYVLRTI 418
>Y1798_ARCFU (O28476) Putative phosphate permease AF1798| Length = 333 Score = 31.6 bits (70), Expect = 1.4 Identities = 12/32 (37%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSV-VYTLIL 402 V + V++I+ SW+VT+PV A +++ +YT+++ Sbjct: 299 VNLKIVQKIIFSWIVTVPVAAAMTISLYTMMV 330
>LET1_KLULA (P53998) Protein LET1| Length = 469 Score = 30.4 bits (67), Expect = 3.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = +2 Query: 344 SKQRLYLTKHSHKVFXESWSRL 409 S + + L+K SHKVF E WS L Sbjct: 65 SSEEILLSKQSHKVFLEKWSEL 86
>Y640_PYRHO (O58374) Putative phosphate permease PH0640| Length = 406 Score = 30.0 bits (66), Expect = 4.1 Identities = 10/32 (31%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPV-GALLSVVYTLIL 402 + V++I++SW VT+PV G + +++ ++L Sbjct: 372 INKSVVKDIIISWFVTVPVAGIIAGIIFKVLL 403
>YE91_HELPJ (Q9ZJC8) Putative phosphate permease jhp_1384| Length = 533 Score = 29.6 bits (65), Expect = 5.3 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 ++ +++IV +W+VT+PV ALL + + L Sbjct: 496 IKRSILKKIVTAWLVTVPVSALLGALLFVAL 526
>Y1491_HELPY (O26024) Putative phosphate permease HP1491| Length = 533 Score = 29.6 bits (65), Expect = 5.3 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLSVVYTLIL 402 ++ +++IV +W+VT+PV ALL + + L Sbjct: 496 IKRSILKKIVTAWLVTVPVSALLGALLFVAL 526
>PIT_BUCAI (P57647) Low-affinity inorganic phosphate transporter| Length = 490 Score = 29.6 bits (65), Expect = 5.3 Identities = 9/24 (37%), Positives = 19/24 (79%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLS 423 ++ +T++ I ++W++T+PV LLS Sbjct: 456 IQTKTIKNIALAWILTLPVSMLLS 479
>THIC_MYCPA (P61426) Thiamine biosynthesis protein thiC| Length = 540 Score = 29.3 bits (64), Expect = 7.0 Identities = 16/40 (40%), Positives = 21/40 (52%), Gaps = 3/40 (7%) Frame = -1 Query: 456 GGHNSSWCFAISR---LYINLDQDS*NTLCECFVRYNLCF 346 G ++WC A R LY N D+ LCE F RY++ F Sbjct: 260 GSIMAAWCLAHHRESFLYTNFDE-----LCEIFARYDVTF 294
>PIT_BUCAP (Q8K903) Low-affinity inorganic phosphate transporter| Length = 493 Score = 28.9 bits (63), Expect = 9.1 Identities = 9/24 (37%), Positives = 18/24 (75%) Frame = -2 Query: 494 VRAETVREIVVSWVVTIPVGALLS 423 ++ T++ I ++W++T+PV LLS Sbjct: 456 IQISTIKNIALAWILTLPVSILLS 479 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,751,943 Number of Sequences: 219361 Number of extensions: 1231718 Number of successful extensions: 2545 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 2497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2545 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)