| Clone Name | rbaal34c05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (... | 33 | 0.14 | 2 | UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate... | 28 | 7.9 |
|---|
>HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (EC 3.4.21.-)| Length = 1409 Score = 33.5 bits (75), Expect = 0.14 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 2/79 (2%) Frame = +2 Query: 47 GVQPSCLSTDC-RGEKAAMELCLTIVLRSTR*TNYFP*KWAQ-KINNRNRATVKVINALA 220 GV P+ +T C R + + C T+ L T+ N P IN N ATV + Sbjct: 705 GVVPNXQNTICTRSDWTGLTTCKTVNLTDTKVINSIPITQINGSINLTNNATVNIHGLAK 764 Query: 221 TRTHVTAPDHSSSSMKQNS 277 +VT DHS ++ N+ Sbjct: 765 LNGNVTLIDHSQFTLSNNA 783
>UXAC_BACLD (Q65F21) Uronate isomerase (EC 5.3.1.12) (Glucuronate isomerase)| (Uronic isomerase) Length = 473 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 217 ESIDHLDCSPVTVVYFLRPFLGEIISSAC 131 +S+D D P T++Y L P +ISS C Sbjct: 333 DSLDRKDALPKTILYSLNPRDNVVISSLC 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,071,999 Number of Sequences: 219361 Number of extensions: 555505 Number of successful extensions: 945 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 888 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 943 length of database: 80,573,946 effective HSP length: 69 effective length of database: 65,438,037 effective search space used: 1570512888 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)