| Clone Name | rbaal34c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IRA1_YEAST (P18963) Inhibitory regulator protein IRA1 | 30 | 7.6 | 2 | OXAA_HELPY (O25989) Inner membrane protein oxaA | 30 | 7.6 |
|---|
>IRA1_YEAST (P18963) Inhibitory regulator protein IRA1| Length = 3092 Score = 29.6 bits (65), Expect = 7.6 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 9/56 (16%) Frame = -3 Query: 437 ILLNHNPCELRDYAAL-LYHCGY--------YKECLQYLTSYQNAMVFHLQILYSA 297 +L++H EL L L+ C Y Y + LQ+L+SY +FH +LY A Sbjct: 242 LLISHTSTELGVVNHLDLFGCEYLTDKNLLAYLDILQHLSSYMKRTIFHSLLLYYA 297
>OXAA_HELPY (O25989) Inner membrane protein oxaA| Length = 547 Score = 29.6 bits (65), Expect = 7.6 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 6/63 (9%) Frame = -3 Query: 371 YKECLQYLTSYQNAMVFHLQILYSAIVNATPPLNATL*VGQPRTNPLEM------LEDDA 210 Y + +YLT Q + H+ L+S+ NA PPL + + PLE+ L + A Sbjct: 94 YLKDKKYLTPKQKGFLEHVGHLFSSKENAQPPLKELPLLAADKLKPLEVRFLDPTLNNKA 153 Query: 209 VNT 201 NT Sbjct: 154 FNT 156 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,319,904 Number of Sequences: 219361 Number of extensions: 1952316 Number of successful extensions: 4113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4018 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4111 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)