| Clone Name | rbaal34b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RLUB_XANAC (Q8PK58) Ribosomal large subunit pseudouridine syntha... | 32 | 1.7 | 2 | PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presyna... | 25 | 4.0 | 3 | MK03_HUMAN (P27361) Mitogen-activated protein kinase 3 (EC 2.7.1... | 30 | 6.3 | 4 | GPC6A_RAT (Q70VB1) G-protein coupled receptor family C group 6 m... | 29 | 8.2 |
|---|
>RLUB_XANAC (Q8PK58) Ribosomal large subunit pseudouridine synthase B (EC| 5.4.99.-) (rRNA-uridine isomerase B) (rRNA pseudouridylate synthase B) Length = 550 Score = 31.6 bits (70), Expect = 1.7 Identities = 17/35 (48%), Positives = 19/35 (54%), Gaps = 3/35 (8%) Frame = -3 Query: 553 TGQAHP---REAGAVQPGVPGRVGAVDGEPRRGQG 458 TGQA P + G +PG G VGA G P RG G Sbjct: 410 TGQARPYAKKGPGGARPGTGGPVGARSGGPGRGAG 444
>PCLO_RAT (Q9JKS6) Protein piccolo (Aczonin) (Multidomain presynaptic| cytomatrix protein) Length = 5085 Score = 24.6 bits (52), Expect(2) = 4.0 Identities = 18/48 (37%), Positives = 20/48 (41%) Frame = +2 Query: 359 TTSVPSWTPPWALSPWKASKLR*MLFTMRTQRKPLPTSRLSVHSTDSS 502 TT P+ T P S + L T P PTS LS HS SS Sbjct: 2471 TTQKPTDTCPKPTGLSLTSTMSLNLVTSADYNVPSPTSPLSPHSNKSS 2518 Score = 23.9 bits (50), Expect(2) = 4.0 Identities = 9/23 (39%), Positives = 14/23 (60%) Frame = +3 Query: 486 TAPTRPGTPGCTAPASRGWAWPV 554 T P+ PGTP ++ A +WP+ Sbjct: 2533 TLPSEPGTPTDSSAAQAITSWPL 2555
>MK03_HUMAN (P27361) Mitogen-activated protein kinase 3 (EC 2.7.11.24)| (Extracellular signal-regulated kinase 1) (ERK-1) (Insulin-stimulated MAP2 kinase) (MAP kinase 1) (MAPK 1) (p44-ERK1) (ERT2) (p44-MAPK) (Microtubule-associated protein 2 kinase) Length = 379 Score = 29.6 bits (65), Expect = 6.3 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 550 GQAHPREAGAVQPGVPGRVGAVDGEP 473 G PR V PGVPG V V G+P Sbjct: 10 GGGEPRRTEGVGPGVPGEVEMVKGQP 35
>GPC6A_RAT (Q70VB1) G-protein coupled receptor family C group 6 member A| precursor Length = 928 Score = 29.3 bits (64), Expect = 8.2 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = -1 Query: 414 DAFHGDKAHGGVHDGTEVVLWKWCEG 337 ++FH D AHG ++ G EVVLWK G Sbjct: 460 NSFHFD-AHGDLNTGYEVVLWKETNG 484 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,754,415 Number of Sequences: 219361 Number of extensions: 1162604 Number of successful extensions: 4699 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4431 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4698 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)