| Clone Name | rbaal34a05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNAS8_SAGOE (Q8SPZ4) Ribonuclease 8 precursor (EC 3.1.27.-) (RNa... | 29 | 4.1 |
|---|
>RNAS8_SAGOE (Q8SPZ4) Ribonuclease 8 precursor (EC 3.1.27.-) (RNase 8)| Length = 155 Score = 28.9 bits (63), Expect = 4.1 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = -2 Query: 147 SQGHHEQSVSPPPQQFNKCLRRITNLHTWC 58 SQ Q V P PQ + +R I N WC Sbjct: 36 SQWFKTQDVQPSPQACDSAMRNINNYKKWC 65 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,514,621 Number of Sequences: 219361 Number of extensions: 217375 Number of successful extensions: 516 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 510 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 514 length of database: 80,573,946 effective HSP length: 25 effective length of database: 75,089,921 effective search space used: 1802158104 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)