| Clone Name | rbaal33i20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precurs... | 30 | 3.6 | 2 | SP96_DICDI (P14328) Spore coat protein SP96 | 29 | 4.7 | 3 | ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.... | 28 | 8.1 |
|---|
>PA2GX_HUMAN (O15496) Group 10 secretory phospholipase A2 precursor (EC 3.1.1.4)| (Group X secretory phospholipase A2) (Phosphatidylcholine 2-acylhydrolase GX) (GX sPLA2) (sPLA2-X) Length = 155 Score = 29.6 bits (65), Expect = 3.6 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -2 Query: 340 CFCGCHGNWRSRRFWNWCAHWDSC 269 CFCG G+ + R +WC H C Sbjct: 57 CFCGLGGHGQPRDAIDWCCHGHDC 80
>SP96_DICDI (P14328) Spore coat protein SP96| Length = 600 Score = 29.3 bits (64), Expect = 4.7 Identities = 15/34 (44%), Positives = 21/34 (61%) Frame = +2 Query: 344 SMSSATNPASTAVXTISPTSRLTTAVNAFTESLT 445 S SSA++ A+TA TI+ T+ TTA T + T Sbjct: 527 SSSSASSAATTAATTIATTAATTTATTTATTATT 560
>ATKA_PSEPK (Q88FD7) Potassium-transporting ATPase A chain (EC 3.6.3.12)| (Potassium-translocating ATPase A chain) (ATP phosphohydrolase [potassium-transporting] A chain) (Potassium-binding and translocating subunit A) Length = 564 Score = 28.5 bits (62), Expect = 8.1 Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 447 AVRDSVNALT---AVVNLEVGEIVXTAVEAGFVAL 352 A+ DS+N LT A+VN+ VGE++ V AG + Sbjct: 353 AMHDSLNPLTGMVAMVNMMVGEVIFGGVGAGLYGM 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,238,903 Number of Sequences: 219361 Number of extensions: 536930 Number of successful extensions: 1098 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1097 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)