| Clone Name | rbaal33h20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATG9_YEAST (Q12142) Autophagy-related protein 9 (Cytoplasm to va... | 29 | 9.2 | 2 | Y040_MYCPN (P75074) Hypothetical protein MPN040 (B01_orf103b) | 29 | 9.2 | 3 | MOK12_SCHPO (Q9UUL4) Cell wall alpha-1,3-glucan synthase mok12 (... | 29 | 9.2 |
|---|
>ATG9_YEAST (Q12142) Autophagy-related protein 9 (Cytoplasm to vacuole| targeting protein 7) Length = 997 Score = 29.3 bits (64), Expect = 9.2 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 4/36 (11%) Frame = +3 Query: 309 ITLHNDPIPAYQKPISLFRTSILTRAL----NICLI 404 I L+N I PI LFRT++LT+ L N+C++ Sbjct: 469 IALYNSDILNLSLPIPLFRTNVLTKTLEWNINLCVM 504
>Y040_MYCPN (P75074) Hypothetical protein MPN040 (B01_orf103b)| Length = 103 Score = 29.3 bits (64), Expect = 9.2 Identities = 23/79 (29%), Positives = 37/79 (46%) Frame = +3 Query: 282 KRISFGLKNITLHNDPIPAYQKPISLFRTSILTRALNICLIS*SGVATSICPCVDSLALF 461 KR SF +KN+T + + A + F +S A ++C S + S C S A Sbjct: 11 KRPSFDVKNLTKPSRLLSATLRSSCAFLSSASFFACSLCFFCCSSI--SFCSLASSSARL 68 Query: 462 EASNLY*AFFLRIVFQRIG 518 S+ + +FF ++F R G Sbjct: 69 RYSSSH-SFFCWVLFSRSG 86
>MOK12_SCHPO (Q9UUL4) Cell wall alpha-1,3-glucan synthase mok12 (EC 2.4.1.183)| Length = 2352 Score = 29.3 bits (64), Expect = 9.2 Identities = 12/35 (34%), Positives = 22/35 (62%) Frame = -2 Query: 335 WNRIIVQCYVFQSKTDSFRW*NPRQLFSLNNREIF 231 WN++++Q + + T F +PR L+ L N++IF Sbjct: 443 WNQMLIQDDMINANTKKF---DPRHLYGLTNQDIF 474 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,291,752 Number of Sequences: 219361 Number of extensions: 1634658 Number of successful extensions: 3353 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3352 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5310515667 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)