| Clone Name | rbaal33f18 |
|---|---|
| Clone Library Name | barley_pub |
>ATL4C_ARATH (Q9M0R5) Putative RING-H2 finger protein ATL4C precursor| Length = 345 Score = 38.1 bits (87), Expect = 0.012 Identities = 19/35 (54%), Positives = 28/35 (80%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVA 374 RS+S HSL V +L +L+RFTL+LPE V+R++V+ Sbjct: 224 RSHSTGHSL-VQQLGENLDRFTLQLPEEVQRQLVS 257
>ATL2F_ARATH (O64762) Putative RING-H2 finger protein ATL2F| Length = 302 Score = 37.4 bits (85), Expect = 0.021 Identities = 30/71 (42%), Positives = 39/71 (54%), Gaps = 10/71 (14%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREM-------VAAGEQSAHRRAQR---AGR 329 RS+S HS+ V LD +L+RFTLRLPE VRR++ VA + + RR R AG Sbjct: 197 RSHSTGHSV-VQPLD-NLDRFTLRLPEEVRRQLTKKTVDNVAFSQARSSRRGYRSRSAGS 254 Query: 328 WPSFLRYTRTL 296 S Y R + Sbjct: 255 ERSVFSYQRRM 265
>ATL2G_ARATH (O64763) RING-H2 finger protein ATL2G precursor (RING-H2 finger| protein ATL9) Length = 378 Score = 36.2 bits (82), Expect = 0.046 Identities = 18/42 (42%), Positives = 27/42 (64%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVAAGEQSAH 353 RS+S HSL ++ +L+RFTLRLP+ VRR+++ H Sbjct: 254 RSHSTGHSL--IQPAGNLDRFTLRLPDDVRRQLMKTSRTMGH 293
>ATL1H_ARATH (Q9C7I1) Putative RING-H2 finger protein ATL1H precursor| Length = 327 Score = 34.7 bits (78), Expect = 0.13 Identities = 19/33 (57%), Positives = 27/33 (81%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREM 380 RS+S HSL V R++ +L+RFTL+LPE VRR++ Sbjct: 250 RSHSTGHSL-VPRVE-NLDRFTLQLPEEVRRQL 280
>ATL4D_ARATH (Q9M0R4) Putative RING-H2 finger protein ATL4D precursor| Length = 357 Score = 34.7 bits (78), Expect = 0.13 Identities = 17/35 (48%), Positives = 28/35 (80%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVA 374 RS+S HSL V+ ++++RFTL+LPE V+R++V+ Sbjct: 234 RSHSTGHSL--VQPCQNIDRFTLQLPEEVQRQLVS 266
>ATL4B_ARATH (Q9M0R6) Putative RING-H2 finger protein ATL4B precursor| Length = 302 Score = 31.2 bits (69), Expect = 1.5 Identities = 14/30 (46%), Positives = 25/30 (83%) Frame = -2 Query: 463 DHSLPVVRLDRDLERFTLRLPEHVRREMVA 374 +HSL ++L +L+RFTL+LPE ++R++V+ Sbjct: 192 EHSL--LQLGTNLDRFTLQLPEEMQRQLVS 219
>ATL3B_ARATH (Q8RXX9) RING-H2 finger protein ATL3B precursor (RING-H2 finger| protein ATL6) Length = 398 Score = 31.2 bits (69), Expect = 1.5 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMV 377 RS++ HS VV+ ERFTLRLPE VR+ ++ Sbjct: 237 RSHTTGHS--VVQPGECTERFTLRLPEDVRKRIM 268
>ATL5H_ARATH (Q8LGA5) RING-H2 finger protein ATL5H precursor| Length = 368 Score = 30.0 bits (66), Expect = 3.3 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVA 374 RS++ HS VV +RFTLR+PE +R++++A Sbjct: 206 RSHTTGHS--VVLPGESTDRFTLRVPEELRKKIMA 238
>ATL4I_ARATH (O49691) Putative RING-H2 finger protein ATL4I| Length = 289 Score = 30.0 bits (66), Expect = 3.3 Identities = 15/40 (37%), Positives = 25/40 (62%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVAAGEQS 359 RS+S HS+ V + +++TLRLPEHV+ ++ Q+ Sbjct: 220 RSHSTGHSI-VRNKPEEEDKYTLRLPEHVKIKVTRGHSQT 258
>EME1_SCHPO (Q9C103) Crossover junction endonuclease eme1 (EC 3.1.22.-)| (Essential meiotic endonuclease 1) Length = 738 Score = 29.6 bits (65), Expect = 4.3 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 165 DTPPRSTKCTAATR-FPLILVDDEEDTSPPSELSVLLGVEKNLPDSVLVYL 314 DTP RST+C + + F LV ED P ++ + +K++ D++L+ L Sbjct: 47 DTPQRSTQCDSLLKSFSTPLVSGSEDVLPSPRDALNITNKKSVTDNLLLSL 97
>ATL4O_ARATH (Q8W571) RING-H2 finger protein ATL4O precursor| Length = 322 Score = 29.6 bits (65), Expect = 4.3 Identities = 16/35 (45%), Positives = 21/35 (60%) Frame = -2 Query: 478 RSYSADHSLPVVRLDRDLERFTLRLPEHVRREMVA 374 RS S HS+ R ERFTLRLP+ V+ ++A Sbjct: 218 RSNSTGHSMD--RFSDGTERFTLRLPDDVKMRLMA 250
>Y4DW_RHISN (P55422) Hypothetical 22.9 kDa protein y4dW| Length = 204 Score = 29.3 bits (64), Expect = 5.6 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +2 Query: 272 RRRKEPSRQRPGVPQERWPSAGSLCAAMRALLP 370 ++RK R RP +P+E+WP+ +A A +P Sbjct: 154 QKRKRGYRPRPSLPKEKWPAEAEHESATSAPVP 186
>YD73_SCHPO (Q10328) Putative homeobox protein C32A11.03c in chromosome I| Length = 942 Score = 28.9 bits (63), Expect = 7.3 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 2/62 (3%) Frame = +3 Query: 174 PRSTKCT-AATRFPLILVDDEEDTSPPSELSVLLGVEKNLPD-SVLVYLRNDGHLPALCA 347 P+S K A + +L + +DT+PP + +G E N+P+ SV ++ +N L + Sbjct: 166 PKSKKQRLTADQLAYLLREFSKDTNPPPAIREKIGRELNIPERSVTIWFQNRRAKSKLIS 225 Query: 348 RR 353 RR Sbjct: 226 RR 227
>CTTB2_CALJA (Q2QLF8) Cortactin-binding protein 2 (CortBP2)| Length = 1662 Score = 28.9 bits (63), Expect = 7.3 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 8/55 (14%) Frame = -3 Query: 240 CPLHR------RRGLEGSAWPPCISSNAAACPVPK--SALWRSMWTRTRQLAGRF 100 CPL R R +G ++P I S+ +C K S WR + T R+ +GRF Sbjct: 1414 CPLPRAELEQHRADFKGGSFPLSIVSSYNSCSKKKGESGAWRKVNTSPRRKSGRF 1468
>POLR_DROME (P16423) Retrovirus-related Pol polyprotein from type-2| retrotransposable element R2DM (Retrovirus-related Pol polyprotein from type II retrotransposable element R2DM) [Includes: Protease (EC 3.4.23.-); Reverse transcriptase (EC 2.7.7.49); End Length = 1057 Score = 28.5 bits (62), Expect = 9.6 Identities = 19/67 (28%), Positives = 28/67 (41%), Gaps = 2/67 (2%) Frame = +2 Query: 269 PRRRKEPSRQRPGVPQERWPSAGSLCAAMRALLPGRDH--LPAHVLRQPQREPLQVAVEP 442 PR R+E RQ+ V Q W C +++LL G D +P+ + P + P Sbjct: 266 PRNRRESRRQQYAVVQRNWDKHKGRC--IKSLLNGTDESVMPSQEIMVPYWREVMTQPSP 323 Query: 443 DYGEGVV 463 G V Sbjct: 324 SSCSGEV 330 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,120,948 Number of Sequences: 219361 Number of extensions: 1102215 Number of successful extensions: 4119 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 4004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4117 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)