| Clone Name | rbaal33e10 |
|---|---|
| Clone Library Name | barley_pub |
>FBS1_HUMAN (P62706) Fibrosin-1| Length = 177 Score = 30.8 bits (68), Expect = 1.8 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 258 CAWHCGDRRGCLVPIFFLVLQTFLPFRTREPWS 356 CAW CG RG + L+ TF P R PW+ Sbjct: 37 CAWECGSSRG----PWGLLRYTFAPVRACRPWA 65
>RLA0_DROME (P19889) 60S acidic ribosomal protein P0 (DNA-(apurinic or| apyrimidinic site) lyase) (EC 4.2.99.18) (Apurinic-apyrimidinic endonuclease) Length = 317 Score = 30.4 bits (67), Expect = 2.3 Identities = 17/46 (36%), Positives = 27/46 (58%) Frame = -1 Query: 266 PCTFILMHNRATLSGIIFGPETLALADEDIGTRFARGRKHL*AGLC 129 P ++ L+ N+ SG IF PE L + ED+ +F +G +L A +C Sbjct: 182 PFSYGLIVNQVYDSGSIFSPEILDIKPEDLRAKFQQGVANL-AAVC 226
>CLPP3_PROMA (Q7V9L6) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 216 Score = 30.0 bits (66), Expect = 3.0 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Frame = +2 Query: 257 MCMALR**ARMFGSYLLPGPAN--LLAVPNTRALVSSPLSKVQARATTLPI 403 MC L A G++LL G + LA+PN+R ++ PL Q +A + I Sbjct: 113 MCYGL---AASMGAFLLAGGSKGKRLALPNSRIMIHQPLGGAQGQAVEIEI 160
>CLPP3_PROMP (Q7UZK7) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 215 Score = 30.0 bits (66), Expect = 3.0 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 281 ARMFGSYLLPGPAN--LLAVPNTRALVSSPLSKVQARATTLPI 403 A G++LL G A LA+PN+R ++ PL Q +A + I Sbjct: 117 AASMGAFLLSGGAKGKRLALPNSRIMIHQPLGGAQGQAVEIEI 159
>UME6_YEAST (P39001) Transcriptional regulator UME6 (Negative transcriptional| regulator of IME2) Length = 836 Score = 29.6 bits (65), Expect = 3.9 Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 7/44 (15%) Frame = -2 Query: 361 ATDQGSRVRNGKKVCRTRKKIGTKH-------PRLSPQCHAHSF 251 +T QG+R R G +CR RKK T+ RL CH +F Sbjct: 760 STSQGTRSRTGCWICRLRKKKCTEERPHCFNCERLKLDCHYDAF 803
>PAAE_ECOLI (P76081) Probable phenylacetic acid degradation NADH oxidoreductase| paaE (EC 1.-.-.-) Length = 356 Score = 29.6 bits (65), Expect = 3.9 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -2 Query: 451 SREAKALDGQPTQSLRDRQRGRPGLHLRQGATDQGSRVRNGKKVCRT 311 +R+A + Q L++ R RPG HL A+ G +R +CR+ Sbjct: 16 TRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSICRS 62
>CLPP3_PROMT (Q46ID4) ATP-dependent Clp protease proteolytic subunit 3 (EC| 3.4.21.92) (Endopeptidase Clp 3) Length = 194 Score = 28.9 bits (63), Expect = 6.7 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 281 ARMFGSYLLPG--PANLLAVPNTRALVSSPLSKVQARATTLPI 403 A G++LL G LA+PN+R ++ PL Q +A + I Sbjct: 94 AASMGAFLLSGGTKGKRLALPNSRIMIHQPLGGAQGQAVEIEI 136
>E1BL_ADEM1 (P12536) E1B protein, large T-antigen (55 kDa protein)| Length = 433 Score = 28.5 bits (62), Expect = 8.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 246 HQNECAWHCGDRRGCLVPIFFLVLQTFLPFRTR 344 H EC CG R L P + T +P RTR Sbjct: 389 HSRECQCFCGGRHRLLFPSVVHITPTVVPDRTR 421
>RLA0_ORYSA (P41095) 60S acidic ribosomal protein P0| Length = 318 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -1 Query: 284 APITAMPCTFILMHNRATLSGIIFGPETLALADEDIGTRFARG 156 A + P ++ L+ SG +F PE L L ++D+ +FA G Sbjct: 178 AKLGIRPFSYGLVITNVYDSGSVFSPEVLDLTEDDLMEKFASG 220
>HYIN1_AGRVI (Q04557) Indoleacetamide hydrolase (EC 3.5.1.-) (IAH)| (Indole-3-acetamide hydrolase) Length = 462 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/38 (36%), Positives = 23/38 (60%) Frame = +1 Query: 49 IQSVSLSPWFYVLISSQLHRLQLQQYVHKPAYRCFLPR 162 IQ++ P Y L+ SQL + + + V++ A RC+ PR Sbjct: 319 IQNIQ-DPQVYDLVQSQLSKGLISESVYRRALRCYKPR 355
>CLPP_DESDG (Q30Z79) ATP-dependent Clp protease proteolytic subunit (EC| 3.4.21.92) (Endopeptidase Clp) Length = 200 Score = 28.5 bits (62), Expect = 8.7 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 281 ARMFGSYLLPG--PANLLAVPNTRALVSSPLSKVQARATTLPI 403 A G++LL P A+PN+R ++ P+ Q +AT + I Sbjct: 95 AASMGAFLLAAGQPGMRFALPNSRIMIHQPMGGAQGQATDIDI 137 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,129,189 Number of Sequences: 219361 Number of extensions: 1139159 Number of successful extensions: 3024 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2987 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3024 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2968155324 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)