| Clone Name | rbaal33e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURI_STRMU (Q8DSQ5) Glutamate racemase (EC 5.1.1.3) | 30 | 2.2 |
|---|
>MURI_STRMU (Q8DSQ5) Glutamate racemase (EC 5.1.1.3)| Length = 264 Score = 29.6 bits (65), Expect = 2.2 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 82 QNELGPTVEPLQTGTLPQXRISLTXNFFDLSQS 180 QN +GP VE + +G IS+ N+FDL++S Sbjct: 194 QNVMGPDVELIDSGAECVRDISVLLNYFDLNRS 226 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,989,267 Number of Sequences: 219361 Number of extensions: 242576 Number of successful extensions: 414 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)