| Clone Name | rbaal33b24 |
|---|---|
| Clone Library Name | barley_pub |
>INV1_MAIZE (P49175) Beta-fructofuranosidase 1 precursor (EC 3.2.1.26) (Sucrose| 1) (Invertase 1) Length = 670 Score = 38.5 bits (88), Expect = 0.005 Identities = 19/40 (47%), Positives = 27/40 (67%) Frame = -1 Query: 164 AIYXXAGVYLFNNATGARVTTTSLVIHEMDSSYNQAYTAS 45 AIY A V+LFNNAT A V S+ I +++S+Y + Y A+ Sbjct: 627 AIYDSARVFLFNNATHAHVKAKSVKIWQLNSAYIRPYPAT 666
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 33.1 bits (74), Expect = 0.21 Identities = 18/34 (52%), Positives = 25/34 (73%) Frame = -1 Query: 167 EAIYXXAGVYLFNNATGARVTTTSLVIHEMDSSY 66 +AIY A ++LFNNAT A V T SL I +M+S++ Sbjct: 607 KAIYGAARLFLFNNATEATV-TASLKIWQMNSAF 639
>INVA_PHAAU (P29001) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) [Contains: Acid beta-fructofuranosidase 30 kDa subunit; Acid beta-fructofuranosidase 38 kDa subunit] Length = 649 Score = 32.7 bits (73), Expect = 0.28 Identities = 17/34 (50%), Positives = 25/34 (73%) Frame = -1 Query: 167 EAIYXXAGVYLFNNATGARVTTTSLVIHEMDSSY 66 +AIY A ++LFNNAT A V T SL + +M+S++ Sbjct: 605 KAIYGAARLFLFNNATEATV-TASLKVWQMNSAF 637
>INVB_DAUCA (P80065) Beta-fructofuranosidase, soluble isoenzyme I precursor (EC| 3.2.1.26) (Sucrose hydrolase) (Invertase) (Saccharase) Length = 661 Score = 31.6 bits (70), Expect = 0.62 Identities = 14/22 (63%), Positives = 16/22 (72%) Frame = -1 Query: 164 AIYXXAGVYLFNNATGARVTTT 99 AIY A V+LFNNATG VT + Sbjct: 621 AIYSAARVFLFNNATGVSVTAS 642
>INVA_VICFA (Q43857) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 642 Score = 30.4 bits (67), Expect = 1.4 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = -1 Query: 164 AIYXXAGVYLFNNATGARVTTTSLVIHEMDSSYNQAY 54 AIY A ++LFNNA V T SL + +M+S++ + Y Sbjct: 598 AIYGAARLFLFNNAIETNV-TASLKVWQMNSAFIRPY 633
>INVA_LYCES (P29000) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 636 Score = 28.9 bits (63), Expect = 4.0 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = -1 Query: 167 EAIYXXAGVYLFNNATGARVTTTSLVIHEMDSSYNQAY 54 +A+ A +++FNNATGA V T S+ I ++S+ Q++ Sbjct: 595 KAVNGAARLFVFNNATGASV-TASVKIWSLESANIQSF 631
>INV1_CAPAN (P93761) Acid beta-fructofuranosidase AIV-18 (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) Length = 640 Score = 28.5 bits (62), Expect = 5.2 Identities = 14/33 (42%), Positives = 23/33 (69%) Frame = -1 Query: 167 EAIYXXAGVYLFNNATGARVTTTSLVIHEMDSS 69 +A+ A +++FNNATGA + T SL I ++S+ Sbjct: 599 KAVNGAARLFVFNNATGA-IVTASLKIWSLESA 630 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,402,762 Number of Sequences: 219361 Number of extensions: 131314 Number of successful extensions: 338 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 338 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)