| Clone Name | rbaal32m24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYFB_PARUW (Q6MEA6) Phenylalanyl-tRNA synthetase beta chain (EC ... | 30 | 6.2 | 2 | APLP2_HUMAN (Q06481) Amyloid-like protein 2 precursor (Amyloid p... | 30 | 6.2 | 3 | APLP2_RAT (P15943) Amyloid-like protein 2 precursor (Sperm membr... | 30 | 6.2 |
|---|
>SYFB_PARUW (Q6MEA6) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 799 Score = 30.0 bits (66), Expect = 6.2 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = +3 Query: 135 CLGCRNLHVSTMPDWLTACLSTNGVSCISDSQHGENWVKLVSGLP 269 C +N+ V PDWL A + +G+ +++ N+V L G P Sbjct: 220 CRVIKNVKVGASPDWLKAKIEKSGLRSVNNIVDVTNYVLLEMGHP 264
>APLP2_HUMAN (Q06481) Amyloid-like protein 2 precursor (Amyloid protein homolog)| (APPH) (CDEI box-binding protein) (CDEBP) Length = 763 Score = 30.0 bits (66), Expect = 6.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 540 FDYDDSGLPLCQVMVPRPSSPTGCVDAVFITEAD 439 F+ +D + +C+ M+P PT VD F T AD Sbjct: 350 FESEDYCMAVCKAMIPPTPLPTNDVDVYFETSAD 383
>APLP2_RAT (P15943) Amyloid-like protein 2 precursor (Sperm membrane protein| YWK-II) Length = 765 Score = 30.0 bits (66), Expect = 6.2 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -3 Query: 540 FDYDDSGLPLCQVMVPRPSSPTGCVDAVFITEAD 439 F+ +D + +C+ M+P PT VD F T AD Sbjct: 352 FESEDYCMAVCKTMIPPTPLPTNDVDVYFETSAD 385 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,085,381 Number of Sequences: 219361 Number of extensions: 2143944 Number of successful extensions: 4807 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4805 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)