| Clone Name | rbaal33b23 |
|---|---|
| Clone Library Name | barley_pub |
>VS06_ROTPY (Q06386) VP6 protein (Major capsid protein) (Major internal| structural protein) Length = 397 Score = 28.9 bits (63), Expect = 3.3 Identities = 19/47 (40%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +1 Query: 175 VFAINFN-I*LEEILVGATNLPPKRCILFPCHPPFIFDGIPGLVQQL 312 + A NF+ I L LV N+ P LFP PPFIF GL ++ Sbjct: 280 IIARNFDTIRLSFQLVRPPNMTPAVANLFPQAPPFIFHATVGLTLRI 326
>PUNC_MOUSE (Q8BQC3) Putative neuronal cell adhesion molecule precursor| Length = 813 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 264 SSSLHL*WNPWPRTA 308 SSSL L W PWPR A Sbjct: 546 SSSLQLLWKPWPRLA 560
>PUNC_HUMAN (Q8IVU1) Putative neuronal cell adhesion molecule precursor| Length = 814 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = +3 Query: 264 SSSLHL*WNPWPRTA 308 SSSL L W PWPR A Sbjct: 534 SSSLQLLWEPWPRLA 548
>BIS1_SCHPO (O59793) Stress response protein bis1| Length = 384 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/55 (30%), Positives = 23/55 (41%) Frame = +3 Query: 162 NLPPRIRHQLQHMTXRNPCRCHQSSSEALHTVPLSSSLHL*WNPWPRTAAPRPSP 326 NL P R + R+P S S + HT +S W P PR + P+P Sbjct: 328 NLTPAARRLVARSYLRSPLH-GSSPSASRHTALRTSIPKFSWTPTPRVKSTAPTP 381
>DPB2_CRYNE (Q5KEX9) DNA polymerase epsilon subunit B (EC 2.7.7.7) (DNA| polymerase II subunit B) Length = 541 Score = 27.3 bits (59), Expect = 9.7 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 5/40 (12%) Frame = +3 Query: 219 RCHQSSSEALHTVPLSSSLHL*W-----NPWPRTAAPRPS 323 R S +E L ++PL S H + +PW T PRPS Sbjct: 348 RGFNSLAELLQSIPLLHSSHFVFVPGPSDPWSSTTLPRPS 387 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 45,255,009 Number of Sequences: 219361 Number of extensions: 848668 Number of successful extensions: 2315 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2313 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)