| Clone Name | rbaal7o12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YEE9_SCHPO (O13825) Hypothetical protein C19A8.09 in chromosome I | 42 | 3e-04 | 2 | YOS1_YEAST (Q3E834) Protein YOS1 (YIP one suppressor protein 1) | 33 | 0.13 | 3 | NAS25_CAEEL (Q20459) Zinc metalloproteinase nas-25 precursor (EC... | 27 | 9.6 |
|---|
>YEE9_SCHPO (O13825) Hypothetical protein C19A8.09 in chromosome I| Length = 81 Score = 42.4 bits (98), Expect = 3e-04 Identities = 25/57 (43%), Positives = 35/57 (61%), Gaps = 2/57 (3%) Frame = -1 Query: 344 EDRFLGPRGWSMSEVSGNGQTK-SXKGQIVGLIYATQ-FLRMPLIALNVLIIVVKMV 180 EDRFLG GWS S G G + + K +I+ LI A + + PLIA+N ++IV +V Sbjct: 23 EDRFLGRIGWSQSAALGFGDRQDTIKSRILHLIRAIRTVMTFPLIAINTIVIVYNLV 79
>YOS1_YEAST (Q3E834) Protein YOS1 (YIP one suppressor protein 1)| Length = 85 Score = 33.5 bits (75), Expect = 0.13 Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 5/60 (8%) Frame = -1 Query: 344 EDRFLGPRGWSMSE----VSGNGQTKSXKGQIVGLIYATQ-FLRMPLIALNVLIIVVKMV 180 E+RFL G S V G Q + K ++V LI A Q LR+PLI +N+L+IV +++ Sbjct: 25 EERFLRRIGLGRSNDETPVFGQDQN-TTKSKVVQLIGAVQTLLRIPLIGINILVIVYELL 83
>NAS25_CAEEL (Q20459) Zinc metalloproteinase nas-25 precursor (EC 3.4.24.21)| (Nematode astacin 25) Length = 399 Score = 27.3 bits (59), Expect = 9.6 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = -3 Query: 279 VVXGADRGAHLCHSVSADALDSA*CSYHCCENGVXLRLL 163 +V +DR + + +++D++ CS+ C E G+ ++ L Sbjct: 315 IVGPSDRTLQVIYEITSDSIRRQICSFGCYEGGIEVKHL 353 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,870,558 Number of Sequences: 219361 Number of extensions: 617841 Number of successful extensions: 1309 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1308 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)