| Clone Name | rbaal33b04 |
|---|---|
| Clone Library Name | barley_pub |
>HMCN1_HUMAN (Q96RW7) Hemicentin-1 precursor (Fibulin-6) (FIBL-6)| Length = 5635 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/37 (40%), Positives = 16/37 (43%), Gaps = 6/37 (16%) Frame = -3 Query: 467 WPTALGWS------GRGMRERTTGFRSPTPWLGRRPC 375 W T WS G G R+RT G P P G R C Sbjct: 4703 WATWASWSACSVSCGGGARQRTRGCSDPVPQYGGRKC 4739
>GPC3_RAT (P13265) Glypican-3 precursor (Intestinal protein OCI-5)| Length = 597 Score = 28.9 bits (63), Expect = 7.1 Identities = 15/51 (29%), Positives = 20/51 (39%) Frame = +3 Query: 132 KNNRVLDNKSIKEQPWKPXXXXXXXXXXXWCYGSRGTHAPCSYSCCPNARC 284 K+N + + S+ P P C+ S T PC CCP A C Sbjct: 544 KDNEITTSHSVGNMP-SPLKILISVAIYVACFFSWCTDLPCPCLCCPAAPC 593
>LA_AEDAL (Q26457) La protein homolog (La ribonucleoprotein) (La autoantigen| homolog) Length = 383 Score = 28.9 bits (63), Expect = 7.1 Identities = 13/23 (56%), Positives = 17/23 (73%) Frame = +3 Query: 351 RSPGGSLSTRPPSQPWRRRAKTG 419 R+P G ++RPP Q WRR+AK G Sbjct: 359 RTPEGRQASRPP-QEWRRKAKGG 380
>LRP1_CHICK (P98157) Low-density lipoprotein receptor-related protein 1 precursor| (LRP) (Alpha-2-macroglobulin receptor) (A2MR) Length = 4543 Score = 28.9 bits (63), Expect = 7.1 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 222 CYGSRGTHAPCSYSCCPNARCRY*TW 299 C G R P +Y CP+ RC TW Sbjct: 2682 CPGGRKPKCPANYFACPSGRCIPMTW 2707
>CO4_RAT (P08649) Complement C4 precursor [Contains: Complement C4 beta| chain; Complement C4 alpha chain; C4a anaphylatoxin; Complement C4 gamma chain] Length = 1737 Score = 28.5 bits (62), Expect = 9.2 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = -2 Query: 336 ELEEITSWGFVDAMFNIDIEHLDNMNKSKEHGFLGFRNTINSFIAWIDKMKASKV 172 E E+TSW FV + F++D+ H +K+H G + + + + +AS V Sbjct: 351 EEAELTSWPFVSSAFSLDLSH------TKQHLVPGAPFLLQALVREMSGSEASDV 399
>Y434_BUCAP (Q8K9B4) Hypothetical UPF0056 protein BUsg434| Length = 196 Score = 28.5 bits (62), Expect = 9.2 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = +1 Query: 181 SLHLIDPSDEGVDGVTEAEEPMLLAL 258 ++ +I PSDEG +G + EEP L+ L Sbjct: 84 AIKMIFPSDEGNNGTSSEEEPFLVPL 109
>TFB2_ASHGO (Q75B51) RNA polymerase II transcription factor B subunit 2 (RNA| polymerase II transcription factor B p52 subunit) (RNA polymerase II transcription factor B 52 kDa subunit) Length = 514 Score = 28.5 bits (62), Expect = 9.2 Identities = 14/48 (29%), Positives = 27/48 (56%) Frame = -2 Query: 231 FRNTINSFIAWIDKMKASKVVP*CSYCLVLYCSLQRMPPDPILSLIYQ 88 F+NT+N ++ + + S++ + CL +Y L M I+S+I+Q Sbjct: 15 FKNTVNEYLQELPQPVQSRLYQSPATCLAIYRLLSPMAKFFIMSMIFQ 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,899,278 Number of Sequences: 219361 Number of extensions: 1279776 Number of successful extensions: 3559 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 3474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3559 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3130907202 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)