| Clone Name | rbaal32l17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IDH_AZOVI (P16100) Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)... | 37 | 0.053 | 2 | RIR1_ARATH (Q9SJ20) Ribonucleoside-diphosphate reductase large s... | 32 | 2.2 |
|---|
>IDH_AZOVI (P16100) Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)| (Oxalosuccinate decarboxylase) (IDH) Length = 740 Score = 37.4 bits (85), Expect = 0.053 Identities = 41/132 (31%), Positives = 58/132 (43%), Gaps = 8/132 (6%) Frame = -1 Query: 738 PVPDEEKDAVRTAYLRRHPEAFWVDFGDFRFLHIKPKAVRYV-----SGVATAILGSGE- 577 P+ D K AV A P FW+D + K RY+ SG+ IL E Sbjct: 464 PIQDWVKLAVNRARATNTPAVFWLDPARAHDAQVIAKVERYLKDYDTSGLDIRILSPVEA 523 Query: 576 --FSAAEFKEAKVDPISQFSTPIAGHMNKDHADDTKLIVQHSTSVKVDFASIVDVDSLGI 403 FS A +E K D IS + G++ +D+ D I++ TS K+ SIV + S G Sbjct: 524 TRFSLARIREGK-DTIS-----VTGNVLRDYLTDLFPIMELGTSAKM--LSIVPLMSGGG 575 Query: 402 NVKAGYDGTVLK 367 + G G+ K Sbjct: 576 LFETGAGGSAPK 587
>RIR1_ARATH (Q9SJ20) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleoside-diphosphate reductase R1 subunit) (AtRNR1) Length = 816 Score = 32.0 bits (71), Expect = 2.2 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 19/145 (13%) Frame = -1 Query: 666 DFGDFRFLHIKPKAVRYVSGVATAILGSGEFSAAEFKEAKVDPISQFSTPIAGHM-NKDH 490 + G + ++ + + Y S TA+ + F K P+ +AG + +K+ Sbjct: 419 NLGTIKSSNLCTEIIEYTSPTETAVCNLASIALPRFVREKGVPLDSHPPKLAGSLDSKNR 478 Query: 489 ADDTKLIVQHSTSVKVDFASIVDVD---------------SLGINVKAGYDGTVLKLRIP 355 D + + + + +V V+ I+DV+ +GI V+ D +L L +P Sbjct: 479 YFDFEKLAEVTATVTVNLNKIIDVNYYPVETAKTSNMRHRPIGIGVQGLADAFIL-LGMP 537 Query: 354 F--PRRAQDRKDV-KTLIVEMLQAA 289 F P Q KD+ +T+ L+A+ Sbjct: 538 FDSPEAQQLNKDIFETIYYHALKAS 562 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 108,951,050 Number of Sequences: 219361 Number of extensions: 2207893 Number of successful extensions: 6102 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5872 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6100 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 8410191164 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)