| Clone Name | rbaal32j21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cycla... | 30 | 5.1 |
|---|
>CYA1_DROME (P32870) Ca(2+)/calmodulin-responsive adenylate cyclase (EC 4.6.1.1)| (ATP pyrophosphate-lyase) (Protein rutabaga) Length = 2248 Score = 29.6 bits (65), Expect = 5.1 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = -1 Query: 461 GLRSGIRLLAIGAEASKPASRGFHATGVKRMSGHGHDEPYYLHAKHMYNLHRMKH 297 G+ G+ +G++ R T V ++ HGH P++LH+ NL++ +H Sbjct: 1394 GMGMGVGAGVLGSDCFMMPRRDRERTYVPPLNQHGHHPPHHLHSN--LNLNQSQH 1446 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,345,099 Number of Sequences: 219361 Number of extensions: 1209733 Number of successful extensions: 3322 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3321 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)