| Clone Name | rbaal32i19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FA24B_HUMAN (Q8N5W8) Protein FAM24B precursor | 28 | 6.1 | 2 | KIF4A_CHICK (Q90640) Chromosome-associated kinesin KIF4A (Chromo... | 28 | 7.9 |
|---|
>FA24B_HUMAN (Q8N5W8) Protein FAM24B precursor| Length = 94 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/38 (31%), Positives = 16/38 (42%) Frame = +1 Query: 100 NTTPALLCSAVCPAADPSRAHCTCLFFSSRPPCFCAWN 213 N+ + + CPA + C F S PPC C N Sbjct: 54 NSQAKTIATESCPALQCCEGYRMCASFDSLPPCCCDIN 91
>KIF4A_CHICK (Q90640) Chromosome-associated kinesin KIF4A (Chromokinesin)| Length = 1225 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/51 (33%), Positives = 25/51 (49%) Frame = -3 Query: 275 ARGGGVPLEFHAPHPLQNLSKFHAQKQGGREEKNKHVQCALLGSAAGHTAE 123 A GG +P+ ++ P +NL + Q EE K + L AAG TA+ Sbjct: 370 AHGGTLPVSINSMAPSENLQSLMEKNQSLMEENEKLSRG--LSEAAGQTAQ 418 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,748,751 Number of Sequences: 219361 Number of extensions: 716342 Number of successful extensions: 1641 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1641 length of database: 80,573,946 effective HSP length: 67 effective length of database: 65,876,759 effective search space used: 1581042216 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)