| Clone Name | rbaal32h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein) | 28 | 8.0 |
|---|
>TAT_HV1SC (P05906) TAT protein (Transactivating regulatory protein)| Length = 101 Score = 27.7 bits (60), Expect = 8.0 Identities = 18/50 (36%), Positives = 24/50 (48%) Frame = +1 Query: 40 DVRLNWLPHAGWKKTAWTSGCFQCHACSAIGQGRTRTTGLGIFHGGQRRR 189 D RL H G + A + C+ C C Q T GLGI +G ++RR Sbjct: 5 DPRLEPWKHPGSQPKAACTSCY-CKKCCFHCQVCFTTKGLGISYGRKKRR 53 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,912,241 Number of Sequences: 219361 Number of extensions: 715126 Number of successful extensions: 1850 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1783 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1850 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)