| Clone Name | rbaal32g13 |
|---|---|
| Clone Library Name | barley_pub |
>ZFNL1_ORYSA (Q5NAW2) Zinc finger CCCH type domain-containing protein ZFN-like 1| Length = 476 Score = 88.6 bits (218), Expect = 2e-17 Identities = 44/51 (86%), Positives = 45/51 (88%) Frame = -2 Query: 678 SSSPDLRPEYISAKDPSVNQVGSPVAASEPSGSILPKGVFPPDTVMRAQTN 526 S SPDLRPEYIS KD SVNQV SPVAASEP GSILPKGVFP DT+MRAQTN Sbjct: 413 SPSPDLRPEYISTKDQSVNQVTSPVAASEPVGSILPKGVFPADTMMRAQTN 463
>ZFNL3_ORYSA (Q5NAV3) Zinc finger CCCH type domain-containing protein ZFN-like 3| Length = 466 Score = 41.6 bits (96), Expect = 0.002 Identities = 22/51 (43%), Positives = 31/51 (60%) Frame = -2 Query: 678 SSSPDLRPEYISAKDPSVNQVGSPVAASEPSGSILPKGVFPPDTVMRAQTN 526 SSS DLRPEY+ K+ S NQ SP P+G++L + P ++R QT+ Sbjct: 405 SSSSDLRPEYLLTKEFSANQSASPGTTCGPAGAMLK--AYAPHMLIRPQTS 453
>POLN_HEVPA (P33424) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 29.6 bits (65), Expect = 8.8 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 212 WILISIPLVNNSWVRKSPHEEITGFW 135 W++ L+ ++W+ ++P E + GFW Sbjct: 1488 WLIRLYHLIRSAWILQAPKESLRGFW 1513
>POLN_HEVMY (Q04610) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 29.6 bits (65), Expect = 8.8 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 212 WILISIPLVNNSWVRKSPHEEITGFW 135 W++ L+ ++W+ ++P E + GFW Sbjct: 1488 WLIRLYHLIRSAWILQAPKESLRGFW 1513
>POLN_HEVBU (P29324) Non-structural polyprotein (EC 2.7.7.48) (RNA-directed RNA| polymerase/Helicase) Length = 1693 Score = 29.6 bits (65), Expect = 8.8 Identities = 8/26 (30%), Positives = 17/26 (65%) Frame = -3 Query: 212 WILISIPLVNNSWVRKSPHEEITGFW 135 W++ L+ ++W+ ++P E + GFW Sbjct: 1488 WLIRLYHLIRSAWILQAPKESLRGFW 1513 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,330,725 Number of Sequences: 219361 Number of extensions: 2010807 Number of successful extensions: 5323 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5102 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5323 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6655306086 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)