| Clone Name | rbaal32e10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ACKA_BORBU (O51567) Acetate kinase (EC 2.7.2.1) (Acetokinase) | 31 | 0.70 | 2 | ACKA_BORGA (Q660Q0) Acetate kinase (EC 2.7.2.1) (Acetokinase) | 29 | 3.5 | 3 | Y396_HELPY (O25157) Hypothetical protein HP0396 | 28 | 4.5 | 4 | ULP2_YEAST (P40537) Ubiquitin-like-specific protease 2 (EC 3.4.2... | 28 | 5.9 | 5 | C71BW_ARATH (Q9LIP5) Cytochrome P450 71B35 (EC 1.14.-.-) | 28 | 7.7 |
|---|
>ACKA_BORBU (O51567) Acetate kinase (EC 2.7.2.1) (Acetokinase)| Length = 405 Score = 31.2 bits (69), Expect = 0.70 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +1 Query: 7 FTLVIPYTW*KNYPYYEHSWAILPIRQNWGGHGISYSCLLKDKKQIRKSKV 159 F IPY+W KN+ + +G HG+SYS + K +I K+ Sbjct: 161 FLYAIPYSWYKNHNI-----------RKYGFHGLSYSYITKRSSEILNKKI 200
>ACKA_BORGA (Q660Q0) Acetate kinase (EC 2.7.2.1) (Acetokinase)| Length = 405 Score = 28.9 bits (63), Expect = 3.5 Identities = 18/51 (35%), Positives = 26/51 (50%) Frame = +1 Query: 7 FTLVIPYTW*KNYPYYEHSWAILPIRQNWGGHGISYSCLLKDKKQIRKSKV 159 F PY+W Y EH+ IR+ +G HG+SYS + K +I K+ Sbjct: 161 FLYATPYSW-----YKEHN-----IRK-YGFHGLSYSYVTKRSSEILNKKI 200
>Y396_HELPY (O25157) Hypothetical protein HP0396| Length = 616 Score = 28.5 bits (62), Expect = 4.5 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +3 Query: 162 APLPFGLYELKLDVQWGSSVRSHGFSRGYRHTKVPMLA 275 APLP+G+YEL L +GF RG + +P L+ Sbjct: 228 APLPYGIYELML----------YGFMRGKKARVMPCLS 255
>ULP2_YEAST (P40537) Ubiquitin-like-specific protease 2 (EC 3.4.22.-)| Length = 1034 Score = 28.1 bits (61), Expect = 5.9 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = +1 Query: 79 IRQNWGGHGISYSCLLKDKKQIRKSKVKLHSPLASTS*NWMF 204 + N G G++ C +D + ++ S +K HS L STS +F Sbjct: 78 VDNNDEGEGVNSGCSDQDFEPLQSSPLKRHSSLKSTSNGLLF 119
>C71BW_ARATH (Q9LIP5) Cytochrome P450 71B35 (EC 1.14.-.-)| Length = 500 Score = 27.7 bits (60), Expect = 7.7 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 10/46 (21%) Frame = -3 Query: 167 WSFTFDFLICFL----------SFRRQE*LIPCPPQFCLIGNMAQL 60 W FL+C L +R+ PCPP F +IGN+ Q+ Sbjct: 5 WLLPLIFLVCILLAVFNHKKHPKYRQ----FPCPPGFPIIGNLHQI 46 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,103,926 Number of Sequences: 219361 Number of extensions: 940969 Number of successful extensions: 2152 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2117 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2151 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)