>HELI_SHV21 (Q01014) Probable ATP-dependent helicase 44 (EC 3.6.1.-)|
          Length = 781

 Score = 29.6 bits (65), Expect = 7.3
 Identities = 19/65 (29%), Positives = 23/65 (35%)
 Frame = +1

Query: 28  YSSQVITHACSGPCLLHLCYVHTHMHGTSATNQKKLSYNQLNIQCLVADLLLATSIIPSH 207
           Y+ Q     C G  L   CYV T   G   +      Y  LN  CL+       S   S 
Sbjct: 41  YNDQFDPEQCPGTLLPFTCYVITGTAGAGKSTSISALYQNLN--CLITGATTVASQNLSR 98

Query: 208 CITYY 222
           C+  Y
Sbjct: 99  CLKTY 103


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 77,328,896
Number of Sequences: 219361
Number of extensions: 1321433
Number of successful extensions: 3509
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3384
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3508
length of database: 80,573,946
effective HSP length: 107
effective length of database: 57,102,319
effective search space used: 5538924943
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)