| Clone Name | rbaal31o13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SFMA_ECOLI (P0ABW5) Sfm fimbrial protein, A chain precursor (Typ... | 28 | 5.2 | 2 | SFMA_ECO57 (P0ABW6) Sfm fimbrial protein, A chain precursor (Typ... | 28 | 5.2 | 3 | EBP_HUMAN (Q15125) 3-beta-hydroxysteroid-delta(8),delta(7)-isome... | 28 | 6.8 | 4 | SDK2_HUMAN (Q58EX2) Protein sidekick-2 precursor | 28 | 8.9 |
|---|
>SFMA_ECOLI (P0ABW5) Sfm fimbrial protein, A chain precursor (Type-1A pilin)| Length = 180 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 18 KTDGNSCPTNMNQASSDTIHXPSHRQRGXSDQAPXGKQNA 137 K DGNS TN N + S R +G A G+ NA Sbjct: 132 KPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANA 171
>SFMA_ECO57 (P0ABW6) Sfm fimbrial protein, A chain precursor (Type-1A pilin)| Length = 180 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 18 KTDGNSCPTNMNQASSDTIHXPSHRQRGXSDQAPXGKQNA 137 K DGNS TN N + S R +G A G+ NA Sbjct: 132 KPDGNSFSTNQNLIPGTNVLHFSARYKGTGTSASAGQANA 171
>EBP_HUMAN (Q15125) 3-beta-hydroxysteroid-delta(8),delta(7)-isomerase (EC| 5.3.3.5) (Cholestenol delta-isomerase) (Delta8-delta7 sterol isomerase) (D8-D7 sterol isomerase) (Emopamil-binding protein) Length = 229 Score = 28.1 bits (61), Expect = 6.8 Identities = 14/45 (31%), Positives = 20/45 (44%), Gaps = 2/45 (4%) Frame = -3 Query: 157 TWPRPSRAFCFPCGAWSEXPLCLWE--GMWMVSLDAWFMLVGHEL 29 TW RA P G W LC + G + ++ WF+L +L Sbjct: 45 TWLLSGRAAVVPLGTWRRLSLCWFAVCGFIHLVIEGWFVLYYEDL 89
>SDK2_HUMAN (Q58EX2) Protein sidekick-2 precursor| Length = 2170 Score = 27.7 bits (60), Expect = 8.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 171 PPDPPHGQDPVERSAFXVAPGQRXP 97 PP+PP Q + R +APG R P Sbjct: 2138 PPNPPSQQSTLYRPPSSLAPGSRAP 2162 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,718,091 Number of Sequences: 219361 Number of extensions: 414914 Number of successful extensions: 1159 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1159 length of database: 80,573,946 effective HSP length: 32 effective length of database: 73,554,394 effective search space used: 1765305456 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)