| Clone Name | rbaal31o07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (... | 31 | 2.5 | 2 | OR7A5_HUMAN (Q15622) Olfactory receptor 7A5 (Olfactory receptor ... | 29 | 7.2 | 3 | MSH5_RAT (Q6MG62) MutS protein homolog 5 | 29 | 9.3 | 4 | GLNA_HALVO (P43386) Glutamine synthetase (EC 6.3.1.2) (Glutamate... | 29 | 9.3 | 5 | COX3_MYTED (P41775) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 29 | 9.3 |
|---|
>IL6RB_RAT (P40190) Interleukin-6 receptor beta chain precursor (IL-6R-beta)| (Interleukin 6 signal transducer) (Membrane glycoprotein 130) (gp130) (CD130 antigen) Length = 918 Score = 30.8 bits (68), Expect = 2.5 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 5/60 (8%) Frame = +2 Query: 296 DTIILVH-----QESPETSMEFTMYAKRGATTSVHRAMSPFMCGFILTTLMSGLXCGRSR 460 DT+ +VH +E + EFT + A + + P F+LTTL+ L C R Sbjct: 584 DTLYMVHMAAYTEEGGKDGPEFTFTTLKFAQGEIEAIVVPVCLAFLLTTLLGVLFCFNKR 643
>OR7A5_HUMAN (Q15622) Olfactory receptor 7A5 (Olfactory receptor TPCR92)| Length = 319 Score = 29.3 bits (64), Expect = 7.2 Identities = 15/47 (31%), Positives = 29/47 (61%) Frame = -2 Query: 438 PLISVVKMKPHMKGLIALCTLVVAPLFAYMVNSMDVSGLSWCTRIMV 298 PL +V M PH+ GL+ L + ++ L++ ++ + V LS+CT + + Sbjct: 129 PLHYMVIMNPHLCGLLVLASWTMSALYS-LLQILMVVRLSFCTALEI 174
>MSH5_RAT (Q6MG62) MutS protein homolog 5| Length = 831 Score = 28.9 bits (63), Expect = 9.3 Identities = 19/62 (30%), Positives = 25/62 (40%) Frame = -2 Query: 453 RPHXSPLISVVKMKPHMKGLIALCTLVVAPLFAYMVNSMDVSGLSWCTRIMVSCGVSGAL 274 RPH SP I V++K L+ LC P NS D G +++ SG Sbjct: 543 RPHYSPCIQGVRIKNGRHPLMELCARTFVP------NSTDCGGDQGRVKVITGPNSSGKS 596 Query: 273 TY 268 Y Sbjct: 597 IY 598
>GLNA_HALVO (P43386) Glutamine synthetase (EC 6.3.1.2) (Glutamate--ammonia| ligase) (GS) Length = 454 Score = 28.9 bits (63), Expect = 9.3 Identities = 19/56 (33%), Positives = 25/56 (44%) Frame = +3 Query: 51 ADFDVVYQPMLSPDQVGQKPYTIAAAAMPPL*VKHLPKT*ACRRKPHRPCCCQRLL 218 A D V + + PD V + Y A ++ LPKT A RR+P R Q L Sbjct: 364 AGLDGVEKGLDCPDPVRENIYEFDEAKREEYGIETLPKTSAARRRPRRDEVIQEAL 419
>COX3_MYTED (P41775) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) Length = 265 Score = 28.9 bits (63), Expect = 9.3 Identities = 14/47 (29%), Positives = 21/47 (44%), Gaps = 2/47 (4%) Frame = -3 Query: 194 TMWFPPACSSFWQMLYS*RRHCC--CCYGIWFLSDLVWRQHWLIHYV 60 T+W + W+ +S +RH C W D+VW W + YV Sbjct: 214 TIWLMVSLVRLWRGEFSSQRHFGFEACIWYWHFVDVVWVALWCLVYV 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,289,468 Number of Sequences: 219361 Number of extensions: 1530766 Number of successful extensions: 3635 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3634 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4142954952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)