| Clone Name | rbaal31j23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ENV_HV1ZH (P05881) Envelope polyprotein GP160 precursor [Contain... | 32 | 1.7 | 2 | VHR1_COWPX (P12932) Host range protein 1 | 31 | 2.9 | 3 | YOJL_BACSU (O31852) Hypothetical protein yojL precursor | 31 | 3.8 | 4 | VA09_VACCV (Q85320) Protein A9 | 31 | 3.8 | 5 | ETFB_BACSU (P94550) Electron transfer flavoprotein beta-subunit ... | 30 | 5.0 |
|---|
>ENV_HV1ZH (P05881) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 856 Score = 32.0 bits (71), Expect = 1.7 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = +2 Query: 440 WYMCFTVHINCQVLFGVRVIFGVSFIFIRC*QGY---AYEDKCHAQHEHYYPERIE 598 WY+ + I L G+R++F V I R QGY +++ H Q E PERIE Sbjct: 680 WYIKIFIMI-VGGLIGLRIVFAVLSIINRVRQGYSPLSFQTLTHHQREPDRPERIE 734
>VHR1_COWPX (P12932) Host range protein 1| Length = 669 Score = 31.2 bits (69), Expect = 2.9 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 9/53 (16%) Frame = +2 Query: 536 GYAYEDKCHAQHEHYYPER---------IEHLILLKVNKSCTNREESPCNLKH 667 GYAYE+ H+Q++ Y P I HL ++SC N E C + H Sbjct: 174 GYAYEEY-HSQNDDYQPRNCGTVLHLYIISHLYSESDSRSCVNPEVVKCLINH 225
>YOJL_BACSU (O31852) Hypothetical protein yojL precursor| Length = 414 Score = 30.8 bits (68), Expect = 3.8 Identities = 26/98 (26%), Positives = 46/98 (46%) Frame = -3 Query: 568 LGMTFVFIGISLLAPDENKADTKDDSNSKKDLTIDMNSEAHVPGNCRPRKLPMEETELDD 389 L T +++G SL P+ +K T SNS K T + + + K M +EL Sbjct: 57 LKSTVLYVGQSLKVPESSKKSTTSPSNSSKTSTYTVAYGDSLWMIAKNHK--MSVSELKS 114 Query: 388 MDSFSTSVRVKAKRILSRAKSACSMSLGLGEETISASS 275 ++S S+ + +++ + S+ S S G + + S SS Sbjct: 115 LNSLSSDLIRPGQKLKIKGTSSSSGSNGSKKNSGSNSS 152
>VA09_VACCV (Q85320) Protein A9| Length = 108 Score = 30.8 bits (68), Expect = 3.8 Identities = 26/94 (27%), Positives = 44/94 (46%), Gaps = 12/94 (12%) Frame = -3 Query: 667 MFQIAWTFFSICTGF-VYFQEYQV------FDTLR-----IIMFVLGMTFVFIGISLLAP 524 +FQ+A +C F +YF E ++ F +R I+ VLG+ ++I Sbjct: 16 LFQVANGAIDLCRHFFMYFCEQKLRPNSFWFVVVRAIASMIMYLVLGIALLYISEQDDKK 75 Query: 523 DENKADTKDDSNSKKDLTIDMNSEAHVPGNCRPR 422 + N A+T +DSNS D +E+ + N P+ Sbjct: 76 NTNNANTNNDSNSNNS-NNDKRNESSINSNSSPK 108
>ETFB_BACSU (P94550) Electron transfer flavoprotein beta-subunit (Beta-ETF)| (Electron transfer flavoprotein small subunit) (ETFSS) Length = 257 Score = 30.4 bits (67), Expect = 5.0 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 445 VPGNCRPRKLPMEETELDDMDSFSTSVRVKAKRI 344 +PG + +K P+EE ELDD+D K K I Sbjct: 188 LPGIMKAKKKPLEELELDDLDLDEEDAEPKLKTI 221 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,541,183 Number of Sequences: 219361 Number of extensions: 2071801 Number of successful extensions: 4775 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4653 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4774 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6484657212 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)