ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal31f10 |
|---|---|
| Clone Library Name | barley_pub |
>UBC11_ARATH (P35134) Ubiquitin-conjugating enzyme E2-17 kDa 11 (EC 6.3.2.19)| (Ubiquitin-protein ligase 11) (Ubiquitin carrier protein 11) Length = 148 Score = 176 bits (445), Expect = 2e-44 Identities = 80/91 (87%), Positives = 86/91 (94%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKV+FKTKV+HPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDD Sbjct: 58 PDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAMG 51 PLVPEIAHM K DR++YESTAR WT KYAMG Sbjct: 118 PLVPEIAHMYKTDRSKYESTARSWTQKYAMG 148
>UBC8_ARATH (P35131) Ubiquitin-conjugating enzyme E2-17 kDa 8 (EC 6.3.2.19)| (Ubiquitin-protein ligase 8) (Ubiquitin carrier protein 8) (UBCAT4A) Length = 148 Score = 175 bits (444), Expect = 2e-44 Identities = 80/91 (87%), Positives = 85/91 (93%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKVAF+TKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDD Sbjct: 58 PDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAMG 51 PLVPEIAHM K DR +YE+TAR WT KYAMG Sbjct: 118 PLVPEIAHMYKTDRAKYEATARNWTQKYAMG 148
>UBC4_LYCES (P35135) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 175 bits (444), Expect = 2e-44 Identities = 80/91 (87%), Positives = 85/91 (93%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKVAF+TKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDD Sbjct: 58 PDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAMG 51 PLVPEIAHM K DR +YE+TAR WT KYAMG Sbjct: 118 PLVPEIAHMYKTDRAKYETTARSWTQKYAMG 148
>UBC10_ARATH (P35133) Ubiquitin-conjugating enzyme E2-17 kDa 10/12 (EC 6.3.2.19)| (Ubiquitin-protein ligase 10/12) (Ubiquitin carrier protein 10/12) Length = 148 Score = 175 bits (444), Expect = 2e-44 Identities = 80/91 (87%), Positives = 85/91 (93%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKVAF+TKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDD Sbjct: 58 PDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAMG 51 PLVPEIAHM K D+ +YESTAR WT KYAMG Sbjct: 118 PLVPEIAHMYKTDKNKYESTARSWTQKYAMG 148
>UBC9_ARATH (P35132) Ubiquitin-conjugating enzyme E2-17 kDa 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) (UBCAT4B) Length = 148 Score = 174 bits (442), Expect = 4e-44 Identities = 80/91 (87%), Positives = 85/91 (93%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKVAF+TKVFHPNINSNG+ICLDILK+QWSPALTISKVLLSICSLLTDPNPDD Sbjct: 58 PDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVLLSICSLLTDPNPDD 117 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAMG 51 PLVPEIAHM K D+ +YESTAR WT KYAMG Sbjct: 118 PLVPEIAHMYKTDKNKYESTARTWTQKYAMG 148
>UBC4_YEAST (P15731) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 148 Score = 160 bits (404), Expect = 1e-39 Identities = 71/89 (79%), Positives = 81/89 (91%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPK++F TK++HPNIN+NGNICLDILKDQWSPALT+SKVLLSICSLLTD NPDDP Sbjct: 60 DYPFKPPKISFTTKIYHPNINANGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDP 119 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIAH+ K DR +YE+TAR WT KYA+ Sbjct: 120 LVPEIAHIYKTDRPKYEATAREWTKKYAV 148
>UBC4_SCHPO (P46595) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 159 bits (403), Expect = 1e-39 Identities = 72/89 (80%), Positives = 81/89 (91%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F T+++HPNINSNG+ICLDIL+DQWSPALTISKVLLSICSLLTDPNPDDP Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSLLTDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIAH+ K DR+RYE +AR WT KYA+ Sbjct: 119 LVPEIAHVYKTDRSRYELSAREWTRKYAI 147
>UBC1_COLGL (O74196) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Colletotrichum hard-surface-induced protein 1) Length = 147 Score = 159 bits (403), Expect = 1e-39 Identities = 71/89 (79%), Positives = 81/89 (91%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F T+++HPNINSNG+ICLDIL+DQWSPALTISKVLLSICS+LTDPNPD+P Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDEP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIAH+ K DR RYE+TAR WT KYA+ Sbjct: 119 LVPEIAHVYKTDRARYEATAREWTRKYAI 147
>UBC4_CANAL (P43102) Ubiquitin-conjugating enzyme E2 4 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 147 Score = 157 bits (396), Expect = 8e-39 Identities = 71/89 (79%), Positives = 79/89 (88%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PPK+A TK++HPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTD NPDDP Sbjct: 59 DYPLKPPKIALTTKIYHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDANPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIAH+ K DR +YE+TA+ WT KYA+ Sbjct: 119 LVPEIAHIYKQDRKKYEATAKEWTKKYAV 147
>UBC1_MAGGR (Q9UVR2) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 147 Score = 154 bits (390), Expect = 4e-38 Identities = 69/89 (77%), Positives = 80/89 (89%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F T+++HPNINSNG+ICLDIL+DQWSPALTISKVLLSICS+LTDPNPDDP Sbjct: 59 DYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVLLSICSMLTDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIAH+ + R +YE+TAR WT KYA+ Sbjct: 119 LVPEIAHVYRTARAQYEATAREWTPKYAI 147
>UBC5_YEAST (P15732) Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 148 Score = 153 bits (387), Expect = 9e-38 Identities = 69/89 (77%), Positives = 79/89 (88%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F TK++HPNINS+GNICLDILKDQWSPALT+SKVLLSICSLLTD NPDDP Sbjct: 60 DYPFKPPKVNFTTKIYHPNINSSGNICLDILKDQWSPALTLSKVLLSICSLLTDANPDDP 119 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K D+ +YE+TA+ WT KYA+ Sbjct: 120 LVPEIAQIYKTDKAKYEATAKEWTKKYAV 148
>UBC2_CAEEL (P35129) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) (Lethal protein 70) Length = 147 Score = 153 bits (386), Expect = 1e-37 Identities = 70/89 (78%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR RY AR WT KYAM Sbjct: 119 LVPEIARIYKTDRERYNQLAREWTQKYAM 147
>UBCD1_DROME (P25867) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein effete) Length = 147 Score = 152 bits (383), Expect = 3e-37 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y AR WT KYAM Sbjct: 119 LVPEIARIYKTDREKYNELAREWTRKYAM 147
>UB2D2_XENLA (P62840) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Xubc4) Length = 147 Score = 151 bits (382), Expect = 3e-37 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y AR WT KYAM Sbjct: 119 LVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_RAT (P62839) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 151 bits (382), Expect = 3e-37 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y AR WT KYAM Sbjct: 119 LVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_MOUSE (P62838) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 151 bits (382), Expect = 3e-37 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y AR WT KYAM Sbjct: 119 LVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D2_HUMAN (P62837) Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19)| (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) Length = 147 Score = 151 bits (382), Expect = 3e-37 Identities = 69/89 (77%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y AR WT KYAM Sbjct: 119 LVPEIARIYKTDREKYNRIAREWTQKYAM 147
>UB2D3_RAT (P61078) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) (Phosphoarginine phosphatase) (PAPase) Length = 147 Score = 150 bits (379), Expect = 8e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y +R WT KYAM Sbjct: 119 LVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D3_MOUSE (P61079) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 150 bits (379), Expect = 8e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y +R WT KYAM Sbjct: 119 LVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D3_HUMAN (P61077) Ubiquitin-conjugating enzyme E2 D3 (EC 6.3.2.19)| (Ubiquitin-protein ligase D3) (Ubiquitin carrier protein D3) (Ubiquitin-conjugating enzyme E2-17 kDa 3) (E2(17)KB 3) Length = 147 Score = 150 bits (379), Expect = 8e-37 Identities = 68/89 (76%), Positives = 76/89 (85%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKVAF T+++HPNINSNG+ICLDIL+ QWSPALTISKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKVAFTTRIYHPNINSNGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y +R WT KYAM Sbjct: 119 LVPEIARIYKTDRDKYNRISREWTQKYAM 147
>UB2D1_MOUSE (P61080) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 149 bits (377), Expect = 1e-36 Identities = 66/89 (74%), Positives = 77/89 (86%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPK+AF TK++HPNINSNG+ICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVP+IA + K+D+ +Y AR WT KYAM Sbjct: 119 LVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
>UB2D1_HUMAN (P51668) Ubiquitin-conjugating enzyme E2 D1 (EC 6.3.2.19)| (Ubiquitin-protein ligase D1) (Ubiquitin carrier protein D1) (UbcH5) (Ubiquitin-conjugating enzyme E2-17 kDa 1) (E2(17)KB 1) Length = 147 Score = 149 bits (377), Expect = 1e-36 Identities = 66/89 (74%), Positives = 77/89 (86%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPK+AF TK++HPNINSNG+ICLDIL+ QWSPALT+SKVLLSICSLL DPNPDDP Sbjct: 59 DYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVP+IA + K+D+ +Y AR WT KYAM Sbjct: 119 LVPDIAQIYKSDKEKYNRHAREWTQKYAM 147
>UB2D4_RAT (P70711) Ubiquitin-conjugating enzyme E2 D4 (EC 6.3.2.19)| (Ubiquitin-protein ligase D4) (Ubiquitin carrier protein D4) (Ubiquitin-conjugating enzyme E2-17 kDa 4) (E2(17)KB 4) Length = 147 Score = 146 bits (368), Expect = 1e-35 Identities = 66/89 (74%), Positives = 75/89 (84%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YPF PPKV F T+++HPN+NSNG+ICLDIL+ QWSPALTISKVLLSI SLL DPNPDDP Sbjct: 59 EYPFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDP 118 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 LVPEIA + K DR +Y TAR WT KYAM Sbjct: 119 LVPEIAQIYKTDRDKYNRTAREWTQKYAM 147
>UB2E2_MOUSE (Q91W82) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) Length = 201 Score = 127 bits (319), Expect = 7e-30 Identities = 60/89 (67%), Positives = 68/89 (76%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP D Sbjct: 112 PDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 171 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PLV IA +R ++ AR WT +YA Sbjct: 172 PLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E2_HUMAN (Q96LR5) Ubiquitin-conjugating enzyme E2 E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase E2) (Ubiquitin carrier protein E2) (UbcH8) Length = 201 Score = 127 bits (319), Expect = 7e-30 Identities = 60/89 (67%), Positives = 68/89 (76%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 PDYPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP D Sbjct: 112 PDYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 171 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PLV IA +R ++ AR WT +YA Sbjct: 172 PLVGSIATQYMTNRAEHDRMARQWTKRYA 200
>UB2E1_MOUSE (P52482) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcM3) Length = 193 Score = 125 bits (315), Expect = 2e-29 Identities = 59/89 (66%), Positives = 68/89 (76%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 P+YPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP D Sbjct: 104 PEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 163 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PLV IA +R ++ AR WT +YA Sbjct: 164 PLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UB2E1_HUMAN (P51965) Ubiquitin-conjugating enzyme E2 E1 (EC 6.3.2.19)| (Ubiquitin-protein ligase E1) (Ubiquitin carrier protein E1) (UbcH6) Length = 193 Score = 125 bits (315), Expect = 2e-29 Identities = 59/89 (66%), Positives = 68/89 (76%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 P+YPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP D Sbjct: 104 PEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 163 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PLV IA +R ++ AR WT +YA Sbjct: 164 PLVGSIATQYMTNRAEHDRMARQWTKRYA 192
>UB2E3_MOUSE (P52483) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcM2) Length = 207 Score = 124 bits (311), Expect = 6e-29 Identities = 59/88 (67%), Positives = 67/88 (76%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP DP Sbjct: 119 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADP 178 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 LV IA +R ++ AR WT +YA Sbjct: 179 LVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UB2E3_HUMAN (Q969T4) Ubiquitin-conjugating enzyme E2 E3 (EC 6.3.2.19)| (Ubiquitin-protein ligase E3) (Ubiquitin carrier protein E3) (Ubiquitin-conjugating enzyme E2-23 kDa) (UbcH9) (UbcM2) Length = 207 Score = 124 bits (311), Expect = 6e-29 Identities = 59/88 (67%), Positives = 67/88 (76%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP DP Sbjct: 119 DYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADP 178 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 LV IA +R ++ AR WT +YA Sbjct: 179 LVGSIATQYLTNRAEHDRIARQWTKRYA 206
>UBCD2_DROME (P52485) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 232 Score = 124 bits (310), Expect = 8e-29 Identities = 59/89 (66%), Positives = 68/89 (76%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 P+YPF PPKV F+T+++H NINS G ICLDILKD WSPALTISKVLLSICSLLTD NP D Sbjct: 143 PEYPFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPAD 202 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PLV IA +R ++ AR WT +YA Sbjct: 203 PLVGSIATQYLQNREEHDRIARLWTKRYA 231
>UBE2N_MACFA (Q4R4I1) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 110 bits (276), Expect = 7e-25 Identities = 50/89 (56%), Positives = 63/89 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PKV F TK++HPN++ +G ICLDILKD+WSPAL I VLLSI +LL+ PNPDDP Sbjct: 61 EYPMAAPKVRFMTKIYHPNVDKSGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A K + + TAR WT YAM Sbjct: 121 LANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_RAT (Q9EQX9) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 109 bits (273), Expect = 2e-24 Identities = 50/89 (56%), Positives = 63/89 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PKV F TK++HPN++ G ICLDILKD+WSPAL I VLLSI +LL+ PNPDDP Sbjct: 61 EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A K++ + TAR WT YAM Sbjct: 121 LANDVAEQWKSNEAQAIETARAWTRLYAM 149
>UBE2N_PONPY (Q5R7J6) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) Length = 152 Score = 109 bits (272), Expect = 2e-24 Identities = 50/89 (56%), Positives = 62/89 (69%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PKV F TK++HPN++ G ICLDILKD+WSPAL I VLLSI +LL+ PNPDDP Sbjct: 61 EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A K + + TAR WT YAM Sbjct: 121 LANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_MOUSE (P61089) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 109 bits (272), Expect = 2e-24 Identities = 50/89 (56%), Positives = 62/89 (69%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PKV F TK++HPN++ G ICLDILKD+WSPAL I VLLSI +LL+ PNPDDP Sbjct: 61 EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A K + + TAR WT YAM Sbjct: 121 LANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBE2N_HUMAN (P61088) Ubiquitin-conjugating enzyme E2 N (EC 6.3.2.19)| (Ubiquitin-protein ligase N) (Ubiquitin carrier protein N) (Ubc13) (Bendless-like ubiquitin-conjugating enzyme) Length = 152 Score = 109 bits (272), Expect = 2e-24 Identities = 50/89 (56%), Positives = 62/89 (69%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PKV F TK++HPN++ G ICLDILKD+WSPAL I VLLSI +LL+ PNPDDP Sbjct: 61 EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A K + + TAR WT YAM Sbjct: 121 LANDVAEQWKTNEAQAIETARAWTRLYAM 149
>UBCD3_DROME (P35128) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Protein bendless) Length = 151 Score = 107 bits (268), Expect = 6e-24 Identities = 49/89 (55%), Positives = 62/89 (69%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PKV F TK++HPNI+ G ICLD+LKD+WSPAL I +LLSI +LL+ PNPDDP Sbjct: 61 DYPMSAPKVRFITKIYHPNIDRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A + K + AR WT KYA+ Sbjct: 121 LANDVAELWKVNEAEAIRNAREWTQKYAV 149
>UBE2T_XENLA (Q7ZY08) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 192 Score = 99.4 bits (246), Expect = 2e-21 Identities = 48/92 (52%), Positives = 63/92 (68%), Gaps = 4/92 (4%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILK----DQWSPALTISKVLLSICSLLTDPNP 150 YPF PPK+ F T ++HPNI+S G ICLDILK W PAL IS VL SI L+++PNP Sbjct: 61 YPFEPPKIRFLTPIYHPNIDSAGRICLDILKLPPKGAWRPALNISTVLTSIQLLMSEPNP 120 Query: 149 DDPLVPEIAHMCKADRTRYESTARGWTHKYAM 54 DDPL+ +I+ K +R + S A+ WT K+A+ Sbjct: 121 DDPLMADISSEFKYNRAVFFSNAKKWTEKHAL 152
>UBC13_SCHPO (O13685) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 148 Score = 97.1 bits (240), Expect = 1e-20 Identities = 45/89 (50%), Positives = 59/89 (66%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F TK++HPN++ G ICL LK WSPAL I VLLSI +L+ PNPDDP Sbjct: 60 EYPMMPPNVRFLTKIYHPNVDKLGRICLSTLKKDWSPALQIRTVLLSIQALMGAPNPDDP 119 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAM 54 L ++A + K + + + AR WT KYA+ Sbjct: 120 LDNDVAKIWKENEPQAIANAREWTKKYAV 148
>UBC1_MOUSE (P61087) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 95.9 bits (237), Expect = 2e-20 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 1/88 (1%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 YPF PPKV F TK++HPNI+S G ICLDILKDQW+ A+T+ VLLS+ +LL PDDP Sbjct: 65 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDP 124 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 +A+ K + ++ TAR W H YA Sbjct: 125 QDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_HUMAN (P61086) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 95.9 bits (237), Expect = 2e-20 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 1/88 (1%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 YPF PPKV F TK++HPNI+S G ICLDILKDQW+ A+T+ VLLS+ +LL PDDP Sbjct: 65 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDP 124 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 +A+ K + ++ TAR W H YA Sbjct: 125 QDAVVANQYKQNPEMFKQTARLWAHVYA 152
>UBC1_BOVIN (P61085) Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2(25K)) (Huntingtin-interacting protein 2) (HIP-2) Length = 199 Score = 95.9 bits (237), Expect = 2e-20 Identities = 47/88 (53%), Positives = 60/88 (68%), Gaps = 1/88 (1%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 YPF PPKV F TK++HPNI+S G ICLDILKDQW+ A+T+ VLLS+ +LL PDDP Sbjct: 65 YPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDP 124 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 +A+ K + ++ TAR W H YA Sbjct: 125 QDAVVANQYKQNPEMFKQTARLWAHVYA 152
>COP10_ARATH (Q9LJD7) Constitutive photomorphogenesis protein 10| Length = 182 Score = 95.9 bits (237), Expect = 2e-20 Identities = 40/88 (45%), Positives = 63/88 (71%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYPF PPK+ FKT+++H N+++ G++ ++IL+D WSPALTI+KVL +I S+ P P P Sbjct: 94 DYPFKPPKLVFKTRIYHCNVDTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSP 153 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 +P IA + DR +++ A+ WT ++A Sbjct: 154 ALPVIARLYLTDREKHDEVAKEWTLRFA 181
>UBC1_YEAST (P21734) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 95.5 bits (236), Expect = 3e-20 Identities = 45/89 (50%), Positives = 58/89 (65%), Gaps = 1/89 (1%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 +YPF PPK+ F TKV+HPNI+S G ICLDILK+ WSP +T+ L+S+ +LL P P+D Sbjct: 61 EYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND 120 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 P E+A DR + TA WT YA Sbjct: 121 PQDAEVAQHYLRDRESFNKTAALWTRLYA 149
>UBC13_YEAST (P52490) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 153 Score = 95.5 bits (236), Expect = 3e-20 Identities = 46/88 (52%), Positives = 57/88 (64%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PKV F TK++HPNI+ G ICLD+LK WSPAL I VLLSI +LL PNP+DP Sbjct: 61 DYPMEAPKVRFLTKIYHPNIDRLGRICLDVLKTNWSPALQIRTVLLSIQALLASPNPNDP 120 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYA 57 L ++A + ++ AR WT YA Sbjct: 121 LANDVAEDWIKNEQGAKAKAREWTKLYA 148
>UBE2T_HUMAN (Q9NPD8) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 197 Score = 93.2 bits (230), Expect = 1e-19 Identities = 43/91 (47%), Positives = 61/91 (67%), Gaps = 4/91 (4%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILK----DQWSPALTISKVLLSICSLLTDPNP 150 YPF PP++ F T ++HPNI+S G ICLD+LK W P+L I+ VL SI L+++PNP Sbjct: 61 YPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNP 120 Query: 149 DDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DDPL+ +I+ K ++ + AR WT K+A Sbjct: 121 DDPLMADISSEFKYNKPAFLKNARQWTEKHA 151
>UBE2T_MOUSE (Q9CQ37) Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19)| (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) Length = 204 Score = 90.9 bits (224), Expect = 7e-19 Identities = 43/91 (47%), Positives = 60/91 (65%), Gaps = 4/91 (4%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDIL----KDQWSPALTISKVLLSICSLLTDPNP 150 YPF PP+V F T ++HPNI+S+G ICLDIL K W P+L I+ VL SI L+ +PNP Sbjct: 61 YPFEPPQVRFLTPIYHPNIDSSGRICLDILKLPPKGAWRPSLNIATVLTSIQLLMAEPNP 120 Query: 149 DDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DDPL+ +I+ K ++ + A+ WT +A Sbjct: 121 DDPLMADISSEFKYNKIAFLKKAKQWTEAHA 151
>UBCD4_DROME (P52486) Ubiquitin-conjugating enzyme E2-22 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 199 Score = 89.7 bits (221), Expect = 2e-18 Identities = 45/90 (50%), Positives = 59/90 (65%), Gaps = 1/90 (1%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 YPF PPKV F T+++HPNI+S G ICLDILKD W+ A+T+ VLLS+ +LL PDDP Sbjct: 66 YPFNPPKVRFITRIWHPNISSVTGAICLDILKDNWAAAMTLRTVLLSLQALLAAAEPDDP 125 Query: 140 LVPEIAHMCKADRTRYESTARGWTHKYAMG 51 +A+ K + TA+ WT+ YA G Sbjct: 126 QDAVVAYQFKDKYDLFLLTAKHWTNAYAGG 155
>UBCD6_DROME (P25153) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 151 Score = 87.4 bits (215), Expect = 8e-18 Identities = 39/81 (48%), Positives = 54/81 (66%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +KVFHPN+ ++G ICLDIL+++WSP +S +L SI SLL+DPNP+ P Sbjct: 62 EYPNKPPTVRFVSKVFHPNVYADGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYESTAR 78 A + K +R YE + Sbjct: 122 ANSTAAQLYKENRREYEKRVK 142
>UBC2_WHEAT (P25866) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 85.9 bits (211), Expect = 2e-17 Identities = 39/81 (48%), Positives = 53/81 (65%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPNI ++G+ICLDIL++QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 DYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYESTAR 78 E A M ++ Y R Sbjct: 122 ANSEAARMYSENKREYNRKVR 142
>UBC2_MEDSA (P35130) Ubiquitin-conjugating enzyme E2-17 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 152 Score = 85.9 bits (211), Expect = 2e-17 Identities = 39/81 (48%), Positives = 53/81 (65%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPNI ++G+ICLDIL++QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 DYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYESTAR 78 E A M ++ Y R Sbjct: 122 ANSEAARMFSENKREYNRRVR 142
>UBC2_ARATH (P42745) Ubiquitin-conjugating enzyme E2-17 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 2) (Ubiquitin carrier protein 2) Length = 152 Score = 85.5 bits (210), Expect = 3e-17 Identities = 39/81 (48%), Positives = 52/81 (64%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPNI ++G+ICLDIL++QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 DYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYESTAR 78 E A M + Y R Sbjct: 122 ANSEAARMFSESKREYNRRVR 142
>UBC1_ARATH (P25865) Ubiquitin-conjugating enzyme E2-17 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 152 Score = 85.5 bits (210), Expect = 3e-17 Identities = 39/81 (48%), Positives = 52/81 (64%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPNI ++G+ICLDIL++QWSP ++ +L SI SLL DPNP+ P Sbjct: 62 DYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYESTAR 78 E A M + Y R Sbjct: 122 ANSEAARMYSESKREYNRRVR 142
>UBC3_ARATH (P42746) Ubiquitin-conjugating enzyme E2-17 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 3) (Ubiquitin carrier protein 3) Length = 150 Score = 85.1 bits (209), Expect = 4e-17 Identities = 39/76 (51%), Positives = 52/76 (68%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPNI ++G+ICLDIL++QWSP ++ VL SI SLL DPNPD P Sbjct: 62 DYPNKPPIVRFVSRMFHPNIYADGSICLDILQNQWSPIYDVAAVLTSIQSLLCDPNPDSP 121 Query: 140 LVPEIAHMCKADRTRY 93 E A + ++ Y Sbjct: 122 ANAEAARLFSENKREY 137
>UB2L3_MOUSE (P68037) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcM4) Length = 154 Score = 84.7 bits (208), Expect = 5e-17 Identities = 35/88 (39%), Positives = 55/88 (62%), Gaps = 1/88 (1%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILK-DQWSPALTISKVLLSICSLLTDPNPDD 144 +YPF PPK+ FKTK++HPNI+ G +CL ++ + W PA +V+ S+ +L+ DP P+ Sbjct: 60 EYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEH 119 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKY 60 PL ++A DR ++ A +T KY Sbjct: 120 PLRADLAEEYSKDRKKFCKNAEEFTKKY 147
>UB2L3_HUMAN (P68036) Ubiquitin-conjugating enzyme E2 L3 (EC 6.3.2.19)| (Ubiquitin-protein ligase L3) (Ubiquitin carrier protein L3) (UbcH7) (E2-F1) (L-UBC) Length = 154 Score = 84.7 bits (208), Expect = 5e-17 Identities = 35/88 (39%), Positives = 55/88 (62%), Gaps = 1/88 (1%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILK-DQWSPALTISKVLLSICSLLTDPNPDD 144 +YPF PPK+ FKTK++HPNI+ G +CL ++ + W PA +V+ S+ +L+ DP P+ Sbjct: 60 EYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEH 119 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKY 60 PL ++A DR ++ A +T KY Sbjct: 120 PLRADLAEEYSKDRKKFCKNAEEFTKKY 147
>UBC12_DROME (Q9VSF3) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-) (NEDD8 protein| ligase) (NEDD8 carrier protein) Length = 181 Score = 83.2 bits (204), Expect = 2e-16 Identities = 33/81 (40%), Positives = 56/81 (69%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PPKV T+V+HPNI+ +GN+CL+IL++ W+P L I+ ++ + L +PNP+DP Sbjct: 82 NYPHEPPKVKCATQVYHPNIDLDGNVCLNILREDWNPVLNINSIVYGLQFLFLEPNPEDP 141 Query: 140 LVPEIAHMCKADRTRYESTAR 78 L E A + + +R ++E+ + Sbjct: 142 LNKEAADVLQTNRRQFENNVK 162
>UBE2B_RAT (P63149) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBE2B_RABIT (P63148) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E2(14k)) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBE2B_MOUSE (P63147) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (E214K) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBE2B_HUMAN (P63146) Ubiquitin-conjugating enzyme E2 B (EC 6.3.2.19)| (Ubiquitin-protein ligase B) (Ubiquitin carrier protein B) (HR6B) (hHR6B) (E2-17 kDa) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBE2A_MOUSE (Q9Z255) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (mHR6A) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBE2A_HUMAN (P49459) Ubiquitin-conjugating enzyme E2 A (EC 6.3.2.19)| (Ubiquitin-protein ligase A) (Ubiquitin carrier protein A) (HR6A) (hHR6A) Length = 152 Score = 82.8 bits (203), Expect = 2e-16 Identities = 35/77 (45%), Positives = 54/77 (70%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP +S +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVRFVSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 + A + + ++ YE Sbjct: 122 ANSQAAQLYQENKREYE 138
>UBC12_XENTR (Q6P8D9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 82.0 bits (201), Expect = 3e-16 Identities = 34/80 (42%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV +T V+HPNI+ GN+CL+IL++ W P LTI+ ++ + L +PNP+DPL Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPL 145 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + +R +E + Sbjct: 146 NKEAAEVLQNNRRLFEQNVQ 165
>UBC12_XENLA (Q6DCZ9) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 82.0 bits (201), Expect = 3e-16 Identities = 34/80 (42%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV +T V+HPNI+ GN+CL+IL++ W P LTI+ ++ + L +PNP+DPL Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPL 145 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + +R +E + Sbjct: 146 NKEAAEVLQNNRRLFEQNVQ 165
>UBC12_MOUSE (P61082) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 82.0 bits (201), Expect = 3e-16 Identities = 34/80 (42%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV +T V+HPNI+ GN+CL+IL++ W P LTI+ ++ + L +PNP+DPL Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPL 145 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + +R +E + Sbjct: 146 NKEAAEVLQNNRRLFEQNVQ 165
>UBC12_HUMAN (P61081) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (Ubiquitin-conjugating enzyme E2 M) (NEDD8 protein ligase) (NEDD8 carrier protein) Length = 183 Score = 82.0 bits (201), Expect = 3e-16 Identities = 34/80 (42%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV +T V+HPNI+ GN+CL+IL++ W P LTI+ ++ + L +PNP+DPL Sbjct: 86 YPHDPPKVKCETMVYHPNIDLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPL 145 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + +R +E + Sbjct: 146 NKEAAEVLQNNRRLFEQNVQ 165
>UBC12_CANGA (Q6FVQ8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 187 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/80 (43%), Positives = 51/80 (63%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV K+FHPNI+ +G ICL+IL++ WSPAL + ++L + SL +PN +DPL Sbjct: 91 YPIDPPKVICNNKIFHPNIDPHGKICLNILREDWSPALDLQCIVLGLLSLFQEPNGNDPL 150 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + D+ + + R Sbjct: 151 NKEAAEVLNKDKLEFGNLVR 170
>UBC2_CANGA (Q6FR76) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 167 Score = 81.6 bits (200), Expect = 4e-16 Identities = 37/88 (42%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP PP V F +++FHPN+ +NG ICLDIL+++W+P ++ +L SI SL DPNP P Sbjct: 62 DYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121 Query: 140 LVPEIAHMCKADRTRY-----ESTARGW 72 E A + K +++Y E+ + W Sbjct: 122 ANVEAATLFKDHKSQYIKRVKETVEKSW 149
>UBC2_CRYNE (Q5KN22) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 169 Score = 81.3 bits (199), Expect = 6e-16 Identities = 36/76 (47%), Positives = 50/76 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +K+FHPNI +NG +CLDIL+++WSP ++ +L S+ SLL DPNP P Sbjct: 63 YPNKPPTVRFISKMFHPNIYANGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNPASPA 122 Query: 137 VPEIAHMCKADRTRYE 90 + A + K + YE Sbjct: 123 NVDAAQLFKENLKEYE 138
>UBC2_TRIHA (Q58FS2) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 80.9 bits (198), Expect = 7e-16 Identities = 38/87 (43%), Positives = 55/87 (63%), Gaps = 5/87 (5%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP+V F +++FHPN+ +NG +CLDIL+++WSP ++ VL SI SLL DPN P Sbjct: 63 YPNKPPQVKFISQMFHPNVYANGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPA 122 Query: 137 VPEIAHMCKADRTRY-----ESTARGW 72 E +++ K +R Y E+ R W Sbjct: 123 NVEASNLYKDNRREYIKRVRETVERSW 149
>UBC2_USTMA (Q4PFA5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 185 Score = 80.5 bits (197), Expect = 1e-15 Identities = 35/75 (46%), Positives = 50/75 (66%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +K+FHPN+ +NG +CLDIL+++WSP ++ +L SI SLL DPNP+ P Sbjct: 63 YPNKPPTVKFLSKMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLHDPNPNSPA 122 Query: 137 VPEIAHMCKADRTRY 93 E A + + + Y Sbjct: 123 NAEAASLYRENMKEY 137
>UBC16_SCHPO (Q9P6I1) Ubiquitin-conjugating enzyme E2 16 (EC 6.3.2.19)| (Ubiquitin-protein ligase 16) (Ubiquitin carrier protein 16) Length = 160 Score = 80.5 bits (197), Expect = 1e-15 Identities = 40/91 (43%), Positives = 57/91 (62%), Gaps = 2/91 (2%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNIN-SNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 YP PP V F+TK+ HPNI+ +NG +C+DILK WSPA ++ L+I SLL++ + P Sbjct: 64 YPISPPSVYFQTKIVHPNISWTNGEVCMDILKTHWSPAWSLQSACLAIISLLSNYDASSP 123 Query: 140 LVPEIAHMCK-ADRTRYESTARGWTHKYAMG 51 L + A + + D+T Y S R T+ YA G Sbjct: 124 LNVDAAKLLRTGDKTAYNSLVRCTTYLYAKG 154
>UBC2_ASHGO (Q75EB8) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 170 Score = 80.1 bits (196), Expect = 1e-15 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +++FHPN+ +NG ICLDIL+++W+P ++ +L SI SL DPNP P Sbjct: 62 EYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121 Query: 140 LVPEIAHMCKADRTRY-----ESTARGW 72 E A + K +++Y E+ + W Sbjct: 122 ANVEAATLFKDHKSQYVKRVKETVEKSW 149
>UBC1_CAEEL (P52478) Ubiquitin-conjugating enzyme E2 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 1) (Ubiquitin carrier protein 1) Length = 192 Score = 80.1 bits (196), Expect = 1e-15 Identities = 35/77 (45%), Positives = 53/77 (68%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +K+FHPN+ ++G+ICLDIL+++WSP ++ +L SI SLL +PNP+ P Sbjct: 62 EYPNKPPTVKFISKMFHPNVYADGSICLDILQNRWSPTYDVAAILTSIQSLLDEPNPNSP 121 Query: 140 LVPEIAHMCKADRTRYE 90 A + + +R YE Sbjct: 122 ANSLAAQLYQENRREYE 138
>UBC2_YEAST (P06104) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 172 Score = 80.1 bits (196), Expect = 1e-15 Identities = 36/88 (40%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +++FHPN+ +NG ICLDIL+++W+P ++ +L SI SL DPNP P Sbjct: 62 EYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121 Query: 140 LVPEIAHMCKADRTRY-----ESTARGW 72 E A + K +++Y E+ + W Sbjct: 122 ANVEAATLFKDHKSQYVKRVKETVEKSW 149
>UBC12_ARATH (Q9SDY5) NEDD8-conjugating enzyme Ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme 1) (RUB1-protein ligase 1) (RUB1 carrier protein 1) Length = 184 Score = 79.7 bits (195), Expect = 2e-15 Identities = 35/82 (42%), Positives = 52/82 (63%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 P YP PKV KTKV+HPNI+ GN+CL+IL++ W P L I+ V+ + L T+PN +D Sbjct: 86 PVYPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNSED 145 Query: 143 PLVPEIAHMCKADRTRYESTAR 78 PL + A + + + +E+ R Sbjct: 146 PLNHDAAAVLRDNPKLFETNVR 167
>UBC12_YARLI (Q6C9W0) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 179 Score = 79.7 bits (195), Expect = 2e-15 Identities = 32/82 (39%), Positives = 52/82 (63%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDD 144 P++P PPKV KV+HPNI+ GN+CL+IL++ W P L+++ V++ + L +PN D Sbjct: 79 PNFPHEPPKVKCLQKVYHPNIDLEGNVCLNILREDWKPVLSLNAVMIGLQYLFLEPNASD 138 Query: 143 PLVPEIAHMCKADRTRYESTAR 78 PL + AH A+R ++ + Sbjct: 139 PLNKDAAHQMTANREEFKRNVK 160
>UBC2_DEBHA (Q6BU36) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 168 Score = 79.3 bits (194), Expect = 2e-15 Identities = 36/80 (45%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +++FHPN+ ++G +CLDIL+++WSP +S +L SI SLL DPN P Sbjct: 63 YPNKPPSVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSIQSLLNDPNISSPA 122 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A++ K R++Y R Sbjct: 123 NVEAANLYKDHRSQYIKRVR 142
>UBC2_YARLI (Q6C093) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 151 Score = 79.3 bits (194), Expect = 2e-15 Identities = 35/80 (43%), Positives = 51/80 (63%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +++FHPN+ S+G +CLDIL+++WSP ++ +L S+ SLL DPN P Sbjct: 63 YPNKPPAVKFVSQMFHPNVYSSGELCLDILQNRWSPTYDVAAILTSVQSLLNDPNTSSPA 122 Query: 137 VPEIAHMCKADRTRYESTAR 78 E + + K R +YE R Sbjct: 123 NVEASMLYKDHRQQYEKRVR 142
>UBC84_DROME (P52487) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 153 Score = 79.0 bits (193), Expect = 3e-15 Identities = 33/90 (36%), Positives = 54/90 (60%), Gaps = 1/90 (1%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILK-DQWSPALTISKVLLSICSLLTDPNPD 147 P YPF PPK+ FKTK++HPN++ G +CL I+ D W P +VL ++ +++ +P P+ Sbjct: 59 PQYPFMPPKILFKTKIYHPNVDEKGEVCLPIISTDNWKPTTRTEQVLQALVAIVHNPEPE 118 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 PL ++A + ++ TA +T K A Sbjct: 119 HPLRSDLAEEFVREHKKFMKTAEEFTKKNA 148
>UBC2_KLULA (Q6CUD9) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) Length = 164 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/88 (39%), Positives = 55/88 (62%), Gaps = 5/88 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PP V F +++FHPN+ +NG ICLDIL+++W+P ++ +L SI SL DPNP P Sbjct: 62 EYPNKPPHVKFLSEMFHPNVYANGEICLDILQNRWTPTYDVASILTSIQSLFNDPNPASP 121 Query: 140 LVPEIAHMCKADRTRY-----ESTARGW 72 E A + + +++Y E+ + W Sbjct: 122 ANVEAATLFQDHKSQYVKRVKETVEKSW 149
>UBC2_CANAL (O74201) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 179 Score = 78.6 bits (192), Expect = 4e-15 Identities = 35/80 (43%), Positives = 52/80 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP+V F +++FHPN+ ++G +CLDIL+++WSP +S +L S+ SLL DPN P Sbjct: 63 YPNKPPQVKFISEMFHPNVYASGELCLDILQNRWSPTYDVSSILTSVQSLLNDPNISSPA 122 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A++ K R+ Y R Sbjct: 123 NVEAANLYKDHRSLYVKRVR 142
>UB2EC_XENLA (P56616) Ubiquitin-conjugating enzyme X (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (UBC-X) Length = 179 Score = 78.6 bits (192), Expect = 4e-15 Identities = 37/76 (48%), Positives = 52/76 (68%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP+ P V F T FHPN++S+GNICLDILKD+WS + +LLS+ SLL +PN + PL Sbjct: 89 YPYNAPTVKFVTPCFHPNVDSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPNNESPL 148 Query: 137 VPEIAHMCKADRTRYE 90 P A + + ++T Y+ Sbjct: 149 NPYAAELWQ-NQTAYK 163
>UBC11_SCHPO (O00103) Ubiquitin-conjugating enzyme E2-20 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 176 Score = 78.6 bits (192), Expect = 4e-15 Identities = 33/77 (42%), Positives = 50/77 (64%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP+ PP + F + ++HPN++ +GNICLDILKD+WS + +LLS+ SLL +PN P Sbjct: 87 NYPYSPPTIIFTSPMWHPNVDMSGNICLDILKDKWSAVYNVQTILLSLQSLLGEPNNASP 146 Query: 140 LVPEIAHMCKADRTRYE 90 L + A + D Y+ Sbjct: 147 LNAQAAELWSKDPIEYK 163
>UBC2_NECHA (P78717) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC2) (Ubiquitin carrier protein UBC2) (Radiation sensitivity protein 6) Length = 151 Score = 78.2 bits (191), Expect = 5e-15 Identities = 36/85 (42%), Positives = 52/85 (61%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP+V F +++FHPN+ + G +CLDIL+++WSP ++ VL SI SLL DPN P Sbjct: 63 YPNKPPQVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSPA 122 Query: 137 VPEIAHMCKADRTRYESTARGWTHK 63 E +++ K +R Y R K Sbjct: 123 NVEASNLYKDNRKEYTKRVRETVEK 147
>UBC12_YEAST (P52491) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 188 Score = 78.2 bits (191), Expect = 5e-15 Identities = 32/73 (43%), Positives = 49/73 (67%), Gaps = 1/73 (1%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PPKV K+FHPNI+ GN+CL+IL++ WSPAL + ++ + L +PNP+DPL Sbjct: 90 YPIEPPKVVCLKKIFHPNIDLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPL 149 Query: 137 VPEIAH-MCKADR 102 + A +C+ ++ Sbjct: 150 NKDAAKLLCEGEK 162
>UBC11_YEAST (P52492) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 156 Score = 77.8 bits (190), Expect = 6e-15 Identities = 34/76 (44%), Positives = 49/76 (64%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YPF PP + F + ++HPN++ +GNICLDILK++WS + +LLS+ SLL +PN P Sbjct: 67 NYPFHPPMIKFLSPMWHPNVDKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSP 126 Query: 140 LVPEIAHMCKADRTRY 93 L A + AD Y Sbjct: 127 LNAVAAELWDADMEEY 142
>UB12L_ARATH (Q9ZU75) Probable NEDD8-conjugating enzyme Ubc12-like (EC 6.3.2.-)| (RUB1-conjugating enzyme 2) (RUB1-protein ligase 2) (RUB1 carrier protein 2) Length = 185 Score = 77.8 bits (190), Expect = 6e-15 Identities = 35/80 (43%), Positives = 50/80 (62%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PKV KTKV+HPNI+ GN+CL+IL++ W P L I+ V+ + L T+PN +DPL Sbjct: 89 YPHEAPKVKCKTKVYHPNIDLEGNVCLNILREDWKPVLNINTVIYGLFHLFTEPNYEDPL 148 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + + +E R Sbjct: 149 NHEAAAVLRDNPKTFEYNVR 168
>UBE2I_XENLA (P63282) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI ++LL I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE R K+A Sbjct: 127 DPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_RAT (P63281) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin-conjugating enzyme UbcE2A) Length = 158 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI ++LL I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE R K+A Sbjct: 127 DPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_MOUSE (P63280) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (mUBC9) Length = 158 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI ++LL I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE R K+A Sbjct: 127 DPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_HUMAN (P63279) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) (p18) Length = 158 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI ++LL I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE R K+A Sbjct: 127 DPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBE2I_CHICK (P63283) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 77.4 bits (189), Expect = 8e-15 Identities = 37/90 (41%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI ++LL I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE R K+A Sbjct: 127 DPAQAEAYTIYCQNRVEYEKRVRAQAKKFA 156
>UBC_MIMIV (Q5UQC9) Probable ubiquitin-conjugating enzyme E2 (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 158 Score = 77.0 bits (188), Expect = 1e-14 Identities = 36/84 (42%), Positives = 52/84 (61%), Gaps = 1/84 (1%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-KDQWSPALTISKVLLSICSLLTDPNPDD 144 DYP+ PKV F T + H N+N G+ICL+IL KD W+ +L I ++ SI LL PNP+D Sbjct: 65 DYPYSSPKVKFITPIQHMNVNDKGDICLNILKKDGWNASLNIISIIWSIIVLLDQPNPED 124 Query: 143 PLVPEIAHMCKADRTRYESTARGW 72 P E+A + + D+ Y+ R + Sbjct: 125 PFNSELASLYRNDKLSYDKKIRDY 148
>UB2EC_SPISO (Q95044) Ubiquitin-conjugating enzyme E2-C (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 177 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/77 (45%), Positives = 52/77 (67%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 DYP+ PP V F T +HPN++ +GNICLDILK+ W+ + + +LLS+ SLL +PN P Sbjct: 88 DYPYKPPVVKFTTPCWHPNVDQSGNICLDILKENWTASYDVRTILLSLQSLLGEPNNASP 147 Query: 140 LVPEIAHMCKADRTRYE 90 L + A M +++T Y+ Sbjct: 148 LNAQAADMW-SNQTEYK 163
>UBE2C_MOUSE (Q9D1C1) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 76.3 bits (186), Expect = 2e-14 Identities = 35/69 (50%), Positives = 45/69 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP+ P V F T +HPN+++ GNICLDILKD+WS + +LLSI SLL +PN D PL Sbjct: 89 YPYNAPTVKFLTPCYHPNVDTQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNIDSPL 148 Query: 137 VPEIAHMCK 111 A + K Sbjct: 149 NTHAAELWK 157
>UBC2_ASPFU (Q4WLA7) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) Length = 151 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/87 (40%), Positives = 52/87 (59%), Gaps = 5/87 (5%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +++FHPN+ G +CLDIL+++WSP ++ +L SI SLL DPN P Sbjct: 63 YPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPA 122 Query: 137 VPEIAHMCKADRTRY-----ESTARGW 72 E +++ K +R Y E+ + W Sbjct: 123 NVEASNLYKDNRKEYIKRVRETVEKSW 149
>UBC3_SCHPO (P40984) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase hus5) (Ubiquitin carrier protein hus5) (SUMO protein ligase) (SUMO-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 157 Score = 75.9 bits (185), Expect = 2e-14 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQ--WSPALTISKVLLSICSLLTDPNPD 147 +YP PPK F +FHPN+ +G +CL IL ++ W PA+TI ++LL I LL DPN Sbjct: 67 EYPTRPPKCRFTPPLFHPNVYPSGTVCLSILNEEEGWKPAITIKQILLGIQDLLDDPNIA 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 P E M K D+ YE R + A Sbjct: 127 SPAQTEAYTMFKKDKVEYEKRVRAQARENA 156
>UBC2_SCHPO (P23566) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (RAD6 homolog) Length = 151 Score = 75.5 bits (184), Expect = 3e-14 Identities = 34/80 (42%), Positives = 49/80 (61%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F + +FHPN+ +NG +CLDIL+++WSP ++ +L SI SLL DPN P Sbjct: 63 YPNKPPLVKFVSTMFHPNVYANGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNNASPA 122 Query: 137 VPEIAHMCKADRTRYESTAR 78 E A + + ++ Y R Sbjct: 123 NAEAAQLHRENKKEYVRRVR 142
>UBE2S_HUMAN (Q16763) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 222 Score = 74.7 bits (182), Expect = 5e-14 Identities = 35/81 (43%), Positives = 48/81 (59%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 D+P PPK F TK+FHPN+ +NG IC+++LK W+ L I VLL+I LL PNP+ Sbjct: 69 DFPASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESA 128 Query: 140 LVPEIAHMCKADRTRYESTAR 78 L E + + Y + AR Sbjct: 129 LNEEAGRLLLENYEEYAARAR 149
>UBC2_EMENI (Q96UP5) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (UV sensitivity protein J) Length = 151 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/87 (39%), Positives = 52/87 (59%), Gaps = 5/87 (5%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +++FHPN+ G +CLDIL+++WSP ++ +L SI SLL DPN P Sbjct: 63 YPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSSPA 122 Query: 137 VPEIAHMCKADRTRY-----ESTARGW 72 E +++ + +R Y E+ + W Sbjct: 123 NVEASNLYRDNRKEYIKRVRETVEKSW 149
>UBE2C_HUMAN (O00762) Ubiquitin-conjugating enzyme E2 C (EC 6.3.2.19)| (Ubiquitin-protein ligase C) (Ubiquitin carrier protein C) (UbcH10) Length = 179 Score = 74.7 bits (182), Expect = 5e-14 Identities = 34/69 (49%), Positives = 45/69 (65%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP+ P V F T +HPN+++ GNICLDILK++WS + +LLSI SLL +PN D PL Sbjct: 89 YPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPL 148 Query: 137 VPEIAHMCK 111 A + K Sbjct: 149 NTHAAELWK 157
>UBC21_CAEEL (P52484) Probable ubiquitin-conjugating enzyme E2 21 (EC 6.3.2.19)| (Ubiquitin-protein ligase 21) (Ubiquitin carrier protein 21) Length = 260 Score = 74.3 bits (181), Expect = 7e-14 Identities = 41/103 (39%), Positives = 57/103 (55%), Gaps = 16/103 (15%) Frame = -3 Query: 317 YPFXPPKVA---------------FKTKVFHPNINSN-GNICLDILKDQWSPALTISKVL 186 YPF PPKV F T+++HPNI+S G ICLDILKD+W+ +LT+ VL Sbjct: 80 YPFEPPKVTEIIFHIRAFEYIQAKFVTRIWHPNISSQTGTICLDILKDKWTASLTLRTVL 139 Query: 185 LSICSLLTDPNPDDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 LS+ ++L P P DP +A + + +TA WT +A Sbjct: 140 LSLQAMLCSPEPSDPQDAVVAKQFINNYPMFTATAVYWTSYFA 182
>UBC4_ARATH (P42748) Ubiquitin-conjugating enzyme E2-21 kDa 1 (EC 6.3.2.19)| (Ubiquitin-protein ligase 4) (Ubiquitin carrier protein 4) Length = 187 Score = 73.9 bits (180), Expect = 9e-14 Identities = 37/92 (40%), Positives = 52/92 (56%), Gaps = 3/92 (3%) Frame = -3 Query: 323 PD-YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSIC-SLLTDPN 153 PD YP+ P V F TK++HPN++ +G++CLD++ WSP + V + LL PN Sbjct: 56 PDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPN 115 Query: 152 PDDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 P DPL E A + DR YE + + KYA Sbjct: 116 PSDPLNGEAAALMMRDRPAYEQRVKEYCEKYA 147
>UBE2S_MOUSE (Q921J4) Ubiquitin-conjugating enzyme E2S (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme E2-24 kDa) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-EPF5) Length = 223 Score = 73.9 bits (180), Expect = 9e-14 Identities = 35/81 (43%), Positives = 47/81 (58%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 D+P PPK F TK+FHPN+ NG IC+++LK W+ L I VLL+I LL PNP+ Sbjct: 69 DFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESA 128 Query: 140 LVPEIAHMCKADRTRYESTAR 78 L E + + Y + AR Sbjct: 129 LNEEAGRLLLENYEEYAARAR 149
>UBC5_ARATH (P42749) Ubiquitin-conjugating enzyme E2-21 kDa 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase 5) (Ubiquitin carrier protein 5) Length = 185 Score = 73.9 bits (180), Expect = 9e-14 Identities = 37/92 (40%), Positives = 52/92 (56%), Gaps = 3/92 (3%) Frame = -3 Query: 323 PD-YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVLLSIC-SLLTDPN 153 PD YP+ P V F TK++HPN++ +G++CLD++ WSP + V + LL PN Sbjct: 56 PDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNVFETFLPQLLLYPN 115 Query: 152 PDDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 P DPL E A + DR YE + + KYA Sbjct: 116 PSDPLNGEAAALMMRDRPTYEQRVKEYCEKYA 147
>UBC12_SCHPO (O74549) NEDD8-conjugating enzyme ubc12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 177 Score = 72.8 bits (177), Expect = 2e-13 Identities = 32/81 (39%), Positives = 47/81 (58%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDP 141 +YP PPKV K++HPNI+ GN+CL+IL+ W+P L ++ +L+ + L PN +DP Sbjct: 79 NYPHDPPKVKCLNKIYHPNIDIEGNVCLNILRQDWNPVLNLNSILVGLQFLFLSPNAEDP 138 Query: 140 LVPEIAHMCKADRTRYESTAR 78 L E A D + S R Sbjct: 139 LNKEAAADLHKDPQGFASRVR 159
>UBC6_ARATH (P42750) Ubiquitin-conjugating enzyme E2-21 kDa 3 (EC 6.3.2.19)| (Ubiquitin-protein ligase 6) (Ubiquitin carrier protein 6) Length = 183 Score = 72.0 bits (175), Expect = 3e-13 Identities = 35/89 (39%), Positives = 48/89 (53%), Gaps = 2/89 (2%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNIN-SNGNICLDILKDQWSPALTISKVLLSIC-SLLTDPNPDD 144 YP+ P V F K++HPN++ S+G +CLD++ WSP + V S LL PNP D Sbjct: 59 YPYKSPSVGFVNKIYHPNVDESSGAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSD 118 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 P E A + DR YE + + KYA Sbjct: 119 PFNGEAASLLMRDRAAYELKVKEYCEKYA 147
>UBC12_KLULA (Q6CSW8) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 71.6 bits (174), Expect = 5e-13 Identities = 30/77 (38%), Positives = 48/77 (62%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V +++HPNI+ +GN+CL++L++ W+PAL I +++ I L +PN DPL Sbjct: 87 YPMEPPVVKCMHRIYHPNIDIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRDPL 146 Query: 137 VPEIAHMCKADRTRYES 87 + A D R+E+ Sbjct: 147 NKDAAKTLIEDPLRFEN 163
>UBC2_NEUCR (P52493) Ubiquitin-conjugating enzyme E2 2 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc2) (Ubiquitin carrier protein ubc2) (Mutagen-sensitive protein 8) Length = 151 Score = 71.6 bits (174), Expect = 5e-13 Identities = 34/85 (40%), Positives = 49/85 (57%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V F +++FHPN+ + G +CLDIL+++WSP ++ VL SI SLL DPN Sbjct: 63 YPNKPPSVKFISEMFHPNVYATGELCLDILQNRWSPTYDVAAVLTSIQSLLNDPNTGSRA 122 Query: 137 VPEIAHMCKADRTRYESTARGWTHK 63 +++ K +R Y R K Sbjct: 123 NVAPSNLYKDNRKEYHKRVRETVEK 147
>UBC_ASFB7 (P27949) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 215 Score = 71.6 bits (174), Expect = 5e-13 Identities = 31/69 (44%), Positives = 44/69 (63%), Gaps = 8/69 (11%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQ--------WSPALTISKVLLSICSL 168 P+YP+ PPK+ F ++++HPNI +G +C+ IL WSPA I +LLS+ SL Sbjct: 58 PEYPYAPPKLTFTSEMWHPNIYPDGRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISL 117 Query: 167 LTDPNPDDP 141 L +PNPD P Sbjct: 118 LNEPNPDSP 126
>UBC_ASFM2 (P25869) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 213 Score = 71.2 bits (173), Expect = 6e-13 Identities = 32/69 (46%), Positives = 44/69 (63%), Gaps = 8/69 (11%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQ--------WSPALTISKVLLSICSL 168 P YP+ PP++ F ++++HPNI S+G +C+ IL WSPA I VLLS+ SL Sbjct: 58 PKYPYEPPRLTFTSEMWHPNIYSDGKLCISILHGDNAEEQGMTWSPAQKIDTVLLSVISL 117 Query: 167 LTDPNPDDP 141 L +PNPD P Sbjct: 118 LNEPNPDSP 126
>UBC4_WHEAT (P16577) Ubiquitin-conjugating enzyme E2-23 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 184 Score = 70.9 bits (172), Expect = 8e-13 Identities = 30/89 (33%), Positives = 51/89 (57%), Gaps = 2/89 (2%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINS-NGNICLDILKDQWSPALTISKVL-LSICSLLTDPNPDD 144 YP+ P + F K++HPN++ +G++CLD++ WSP + + + + LL PNP D Sbjct: 59 YPYKSPSIGFTNKIYHPNVDEMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSD 118 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYA 57 PL E A + D+ YE+ + + +YA Sbjct: 119 PLNGEAASLMMRDKNAYENKVKEYCERYA 147
>UBC12_ASHGO (Q75AF2) NEDD8-conjugating enzyme UBC12 (EC 6.3.2.-)| (RUB1-conjugating enzyme) (RUB1-protein ligase) (Ubiquitin carrier protein 12) Length = 184 Score = 70.9 bits (172), Expect = 8e-13 Identities = 30/80 (37%), Positives = 47/80 (58%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPL 138 YP PP V ++HPNI+ +GNICL++L++ WSP + + V+L + L +PN DPL Sbjct: 87 YPIEPPTVKCLNTIYHPNIDYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSDPL 146 Query: 137 VPEIAHMCKADRTRYESTAR 78 + A D R+E+ + Sbjct: 147 NRQAADTMLRDPYRFETNVQ 166
>UBE2I_MESAU (O09181) Ubiquitin-conjugating enzyme E2 I (EC 6.3.2.19)| (Ubiquitin-protein ligase I) (Ubiquitin carrier protein I) (SUMO-1-protein ligase) (SUMO-1-conjugating enzyme) (Ubiquitin carrier protein 9) Length = 158 Score = 70.9 bits (172), Expect = 8e-13 Identities = 33/89 (37%), Positives = 50/89 (56%), Gaps = 2/89 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 DYP PPK F+ +FHPN+ +G +CL IL++ W PA+TI+++ + I LL +PN Sbjct: 67 DYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITINQLFIGIQELLNEPNIQ 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKY 60 +P E + +R YE R K+ Sbjct: 127 EPAQAEAYTIYCQNRVEYEKRFRAQAKKF 155
>UB2G1_RAT (P62255) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 13/86 (15%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F T+++HPN++ NG++C+ IL +++W P T+ +++S Sbjct: 63 DYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMIS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADR 102 + S+L DPN D P + A + DR Sbjct: 123 VISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_MOUSE (P62254) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 13/86 (15%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F T+++HPN++ NG++C+ IL +++W P T+ +++S Sbjct: 63 DYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMIS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADR 102 + S+L DPN D P + A + DR Sbjct: 123 VISMLADPNGDSPANVDAAKEWREDR 148
>UB2G1_HUMAN (P62253) Ubiquitin-conjugating enzyme E2 G1 (EC 6.3.2.19)| (Ubiquitin-protein ligase G1) (Ubiquitin carrier protein G1) (E217K) (UBC7) Length = 169 Score = 69.7 bits (169), Expect = 2e-12 Identities = 30/86 (34%), Positives = 50/86 (58%), Gaps = 13/86 (15%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F T+++HPN++ NG++C+ IL +++W P T+ +++S Sbjct: 63 DYPLRPPKMKFITEIWHPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMIS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADR 102 + S+L DPN D P + A + DR Sbjct: 123 VISMLADPNGDSPANVDAAKEWREDR 148
>UBC9_CAEEL (Q95017) Ubiquitin-conjugating enzyme E2 9 (EC 6.3.2.19)| (Ubiquitin-protein ligase 9) (Ubiquitin carrier protein 9) Length = 166 Score = 69.3 bits (168), Expect = 2e-12 Identities = 32/90 (35%), Positives = 50/90 (55%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 D+P PPK F+ +FHPN+ +G +CL +L + W P+++I ++L+ I LL PN + Sbjct: 67 DFPSTPPKCKFEPPLFHPNVYPSGTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNIE 126 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DP E + +R YE + KYA Sbjct: 127 DPAQAEAYQIYCQNRAEYEKRVKKEAVKYA 156
>UBC8_YEAST (P28263) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Glucose-induced degradation protein 3) Length = 218 Score = 69.3 bits (168), Expect = 2e-12 Identities = 34/90 (37%), Positives = 52/90 (57%), Gaps = 2/90 (2%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNIN-SNGNICLDILKDQWSPALTISKVL-LSICSLLTDPNPD 147 +YP+ P + F K+FHPNI+ ++G+ICLD++ WSP + ++ I LL +PN Sbjct: 58 NYPYKSPSIGFVNKIFHPNIDIASGSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGS 117 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYA 57 DPL E A + D+ YE + + KYA Sbjct: 118 DPLNNEAATLQLRDKKLYEEKIKEYIDKYA 147
>UBC7_CAEEL (P34477) Probable ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 164 Score = 68.6 bits (166), Expect = 4e-12 Identities = 32/90 (35%), Positives = 51/90 (56%), Gaps = 13/90 (14%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD-------------QWSPALTISKVLLS 180 DYP PPK+ F ++++HPNI+ GN+C+ IL D +W P T+ +LLS Sbjct: 62 DYPQKPPKMKFISEIWHPNIDKEGNVCISILHDPGDDKWGYERPEERWLPVHTVETILLS 121 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYE 90 + S+LTDPN + P + A M + + ++ Sbjct: 122 VISMLTDPNFESPANVDAAKMQRENYAEFK 151
>UB2L6_HUMAN (O14933) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcH8) (Retinoic acid-induced gene B protein) (RIG-B) Length = 152 Score = 68.6 bits (166), Expect = 4e-12 Identities = 30/91 (32%), Positives = 52/91 (57%), Gaps = 1/91 (1%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDIL-KDQWSPALTISKVLLSICSLLTDPNPD 147 P+YPF PP + F TK++HPN++ NG ICL I+ + W P +VL ++ L+ PN Sbjct: 58 PEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIR 117 Query: 146 DPLVPEIAHMCKADRTRYESTARGWTHKYAM 54 +PL ++A + + + A +T ++ + Sbjct: 118 EPLRMDLADLLTQNPELFRKNAEEFTLRFGV 148
>UB2G2_PONPY (Q5RF84) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F ++FHPNI +G +C+ IL ++WSP ++ K+LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYESTAR 78 + S+L +PN + + + M + DR ++ A+ Sbjct: 123 VVSMLAEPNDESGANVDASKMWRDDREQFYKIAK 156
>UB2G2_MOUSE (P60605) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F ++FHPNI +G +C+ IL ++WSP ++ K+LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYESTAR 78 + S+L +PN + + + M + DR ++ A+ Sbjct: 123 VVSMLAEPNDESGANVDASKMWRDDREQFYKIAK 156
>UB2G2_HUMAN (P60604) Ubiquitin-conjugating enzyme E2 G2 (EC 6.3.2.19)| (Ubiquitin-protein ligase G2) (Ubiquitin carrier protein G2) Length = 165 Score = 68.2 bits (165), Expect = 5e-12 Identities = 31/94 (32%), Positives = 52/94 (55%), Gaps = 13/94 (13%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F ++FHPNI +G +C+ IL ++WSP ++ K+LLS Sbjct: 63 DYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYESTAR 78 + S+L +PN + + + M + DR ++ A+ Sbjct: 123 VVSMLAEPNDESGANVDASKMWRDDREQFYKIAK 156
>UBC7_SCHPO (O00102) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 166 Score = 65.9 bits (159), Expect = 2e-11 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 13/99 (13%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PP + F+ + FHPN+ +G +C+ IL ++WSP ++ K+LLS Sbjct: 64 DYPLGPPTLKFECEFFHPNVYKDGTVCISILHAPGDDPNMYESSSERWSPVQSVEKILLS 123 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYESTARGWTHK 63 + S+L +PN + + M + DR Y R K Sbjct: 124 VMSMLAEPNDESGANIDACKMWREDREEYCRVVRRLARK 162
>UBC7_YEAST (Q02159) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 165 Score = 64.7 bits (156), Expect = 6e-11 Identities = 29/90 (32%), Positives = 49/90 (54%), Gaps = 13/90 (14%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP PPK+ F + HPNI NG +C+ IL +++WSP ++ K+LLS Sbjct: 63 DYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKILLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYE 90 + S+L++PN + + + + +R +E Sbjct: 123 VMSMLSEPNIESGANIDACILWRDNRPEFE 152
>UBC9_YEAST (P50623) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) Length = 157 Score = 64.7 bits (156), Expect = 6e-11 Identities = 27/62 (43%), Positives = 39/62 (62%), Gaps = 2/62 (3%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKD--QWSPALTISKVLLSICSLLTDPNPD 147 +YP PPKV F +HPN+ +G ICL IL + W PA+T+ +++L + LL PNP+ Sbjct: 67 EYPSKPPKVKFPAGFYHPNVYPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPN 126 Query: 146 DP 141 P Sbjct: 127 SP 128
>UBCX_PICAN (O60015) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 188 Score = 64.3 bits (155), Expect = 7e-11 Identities = 40/112 (35%), Positives = 57/112 (50%), Gaps = 24/112 (21%) Frame = -3 Query: 320 DYPFXPPKVAF-------------KT---------KVFHPNIN-SNGNICLDILKDQWSP 210 +YP PPK+ F KT K+ HPN+N G ICLDIL+ +WSP Sbjct: 70 NYPLDPPKIKFVVFGEEKIRQLQRKTSSGARKVCYKMPHPNVNFKTGEICLDILQQKWSP 129 Query: 209 ALTISKVLLSICSLLTDPNPDDPLVPEIAHMCKA-DRTRYESTARGWTHKYA 57 A T+ L++I LL +P P PL ++A++ K D T Y+ + KY+ Sbjct: 130 AWTLQSALVAIVVLLANPEPLSPLNIDMANLLKCDDTTAYKDLVHYYIAKYS 181
>UB2R1_RABIT (Q29503) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 238 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 13/73 (17%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP+ PP F TK++HPNI NG++C+ IL ++W+P + +LLS Sbjct: 67 DYPYSPPTFRFLTKMWHPNIYENGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 179 ICSLLTDPNPDDP 141 + SLL +PN P Sbjct: 127 VISLLNEPNTFSP 139
>UBE2H_MOUSE (P62257) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UBCH2) (E2-20K) Length = 183 Score = 63.2 bits (152), Expect = 2e-10 Identities = 33/92 (35%), Positives = 50/92 (54%), Gaps = 3/92 (3%) Frame = -3 Query: 323 PD-YPFXPPKVAFKTKVFHPNIN-SNGNICLDILKDQWSPALTISKVLLS-ICSLLTDPN 153 PD YPF P + F K+FHPNI+ ++G +CLD++ W+ ++ + S + LL PN Sbjct: 58 PDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPN 117 Query: 152 PDDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 P DPL + A M Y+ + + KYA Sbjct: 118 PIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYA 149
>UBE2H_HUMAN (P62256) Ubiquitin-conjugating enzyme E2 H (EC 6.3.2.19)| (Ubiquitin-protein ligase H) (Ubiquitin carrier protein H) (UbcH2) (E2-20K) Length = 183 Score = 63.2 bits (152), Expect = 2e-10 Identities = 33/92 (35%), Positives = 50/92 (54%), Gaps = 3/92 (3%) Frame = -3 Query: 323 PD-YPFXPPKVAFKTKVFHPNIN-SNGNICLDILKDQWSPALTISKVLLS-ICSLLTDPN 153 PD YPF P + F K+FHPNI+ ++G +CLD++ W+ ++ + S + LL PN Sbjct: 58 PDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPN 117 Query: 152 PDDPLVPEIAHMCKADRTRYESTARGWTHKYA 57 P DPL + A M Y+ + + KYA Sbjct: 118 PIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYA 149
>UBC3_YEAST (P14682) Ubiquitin-conjugating enzyme E2-34 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Cell division control protein 34) (E3 ubiquitin ligase complex SCF subunit CDC34) Length = 295 Score = 62.4 bits (150), Expect = 3e-10 Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 12/72 (16%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL------------KDQWSPALTISKVLLSI 177 D+PF PP+ F ++HPN+ +G +C+ IL + WSP T+ VL+SI Sbjct: 69 DFPFSPPQFRFTPAIYHPNVYRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVLISI 128 Query: 176 CSLLTDPNPDDP 141 SLL DPN + P Sbjct: 129 VSLLEDPNINSP 140
>UBC14_ARATH (P42747) Ubiquitin-conjugating enzyme E2 14 (EC 6.3.2.19)| (Ubiquitin-protein ligase 14) (Ubiquitin carrier protein 14) (TAYO29) Length = 167 Score = 62.4 bits (150), Expect = 3e-10 Identities = 28/89 (31%), Positives = 49/89 (55%), Gaps = 13/89 (14%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 +YP PP V F ++++HPN+ S+G +C+ IL ++W+P T+ ++LS Sbjct: 64 NYPVSPPTVTFTSEMWHPNVYSDGKVCISILHPPGDDPHGYELASERWTPVHTVESIVLS 123 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRY 93 I S+L+ PN + P E A + +R + Sbjct: 124 IISMLSGPNDESPANVEAAKEWRDNRAEF 152
>UB2L6_MOUSE (Q9QZU9) Ubiquitin-conjugating enzyme E2 L6 (EC 6.3.2.19)| (Ubiquitin-protein ligase L6) (Ubiquitin carrier protein L6) (UbcM8) Length = 152 Score = 62.0 bits (149), Expect = 4e-10 Identities = 27/90 (30%), Positives = 53/90 (58%), Gaps = 1/90 (1%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQ-WSPALTISKVLLSICSLLTDPNPDD 144 +YPF PP + F TK++HPN+ +G +CL ++ ++ W P +VL ++ L++ PN ++ Sbjct: 59 EYPFKPPTLRFTTKIYHPNVREDGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEE 118 Query: 143 PLVPEIAHMCKADRTRYESTARGWTHKYAM 54 P+ E+A + + + A +T K+ + Sbjct: 119 PVRLELADLLTQNPEMFRKKAEEFTLKFGV 148
>UBCY_ARATH (P42743) Ubiquitin-conjugating enzyme E2-18 kDa (EC 6.3.2.19)| (Ubiquitin-conjugating enzyme 15) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (PM42) Length = 161 Score = 62.0 bits (149), Expect = 4e-10 Identities = 38/91 (41%), Positives = 51/91 (56%), Gaps = 7/91 (7%) Frame = -3 Query: 317 YPFXPPKVAFKTKV-FHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLTD------ 159 YP P+V F + HP+I SNG+ICLDIL D WSPA+T++ V +SI S+L+ Sbjct: 73 YPMEAPQVVFVSPAPSHPHIYSNGHICLDILYDSWSPAMTVNSVCISILSMLSSSPAKQR 132 Query: 158 PNPDDPLVPEIAHMCKADRTRYESTARGWTH 66 P +D V CK R+ E+ R W H Sbjct: 133 PADNDRYVKN----CKNGRSPKET--RWWFH 157
>UB2R1_HUMAN (P49427) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 236 Score = 60.8 bits (146), Expect = 8e-10 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 13/73 (17%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP+ PP F TK++HPNI G++C+ IL ++W+P + +LLS Sbjct: 67 DYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 179 ICSLLTDPNPDDP 141 + SLL +PN P Sbjct: 127 VISLLNEPNTFSP 139
>UB2R1_MOUSE (Q8CFI2) Ubiquitin-conjugating enzyme E2-32 kDa complementing (EC| 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (E2-CDC34) Length = 235 Score = 60.8 bits (146), Expect = 8e-10 Identities = 27/73 (36%), Positives = 40/73 (54%), Gaps = 13/73 (17%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 DYP+ PP F TK++HPNI G++C+ IL ++W+P + +LLS Sbjct: 67 DYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLS 126 Query: 179 ICSLLTDPNPDDP 141 + SLL +PN P Sbjct: 127 VISLLNEPNTFSP 139
>UBC15_SCHPO (Q9Y818) Ubiquitin-conjugating enzyme E2 15 (EC 6.3.2.19)| (Ubiquitin-protein ligase 15) (Ubiquitin carrier protein 15) Length = 167 Score = 60.8 bits (146), Expect = 8e-10 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 13/73 (17%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILK-------------DQWSPALTISKVLLS 180 DYP PPK+ F T+++HPN++ NG +C+ IL ++W P + +L+S Sbjct: 64 DYPLMPPKMKFTTEIWHPNVHPNGEVCISILHPPGDDKYGYEDAGERWLPVHSPETILIS 123 Query: 179 ICSLLTDPNPDDP 141 + S+L+ PN + P Sbjct: 124 VISMLSSPNDESP 136
>UBC7_ARATH (Q42540) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 166 Score = 60.1 bits (144), Expect = 1e-09 Identities = 28/90 (31%), Positives = 48/90 (53%), Gaps = 13/90 (14%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 +YP PP V F + ++HPN+ S+G +C+ IL ++W+P T+ ++LS Sbjct: 63 NYPNSPPTVRFTSDMWHPNVYSDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYE 90 I S+L+ PN + P E A + R ++ Sbjct: 123 IISMLSGPNDESPANVEAAKEWRDKRDEFK 152
>UBC13_ARATH (Q42541) Ubiquitin-conjugating enzyme E2 13 (EC 6.3.2.19)| (Ubiquitin-protein ligase 13) (Ubiquitin carrier protein 13) Length = 166 Score = 59.3 bits (142), Expect = 2e-09 Identities = 27/90 (30%), Positives = 47/90 (52%), Gaps = 13/90 (14%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDIL-------------KDQWSPALTISKVLLS 180 +YP PP V F + ++HPN+ +G +C+ IL ++W+P T+ ++LS Sbjct: 63 NYPNSPPTVRFTSDIWHPNVYPDGRVCISILHPPGDDPSGYELASERWTPVHTVESIMLS 122 Query: 179 ICSLLTDPNPDDPLVPEIAHMCKADRTRYE 90 I S+L+ PN + P E A + R ++ Sbjct: 123 IISMLSGPNDESPANVEAAKEWREKRDEFK 152
>UBCX_PICPA (P49428) Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 204 Score = 57.8 bits (138), Expect = 7e-09 Identities = 32/75 (42%), Positives = 45/75 (60%), Gaps = 2/75 (2%) Frame = -3 Query: 272 HPNINSN-GNICLDILKDQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMCKA-DRT 99 HPNI N G ICLDIL+ +W+PA T+S L +I LL DP P PL ++A++ K D Sbjct: 122 HPNIAFNTGEICLDILQAKWTPAWTLSSALTAIVLLLNDPEPLSPLDIDMANLMKINDLK 181 Query: 98 RYESTARGWTHKYAM 54 Y S + +Y++ Sbjct: 182 AYNSLIEYYVGRYSI 196
>UBE2W_MOUSE (Q8VDW4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 57.4 bits (137), Expect = 9e-09 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 317 YPFXPPKVAFKTK--VFHPNINSNGNICLDILKDQWSPALTISKVLLSICSLLT 162 YPF P+V F + HP++ SNG+ICL IL + WSPAL++ V LSI S+L+ Sbjct: 64 YPFDSPQVMFTGENIPIHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117
>UBC7_WHEAT (P25868) Ubiquitin-conjugating enzyme E2 7 (EC 6.3.2.19)| (Ubiquitin-protein ligase 7) (Ubiquitin carrier protein 7) Length = 168 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/93 (26%), Positives = 49/93 (52%), Gaps = 12/93 (12%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICL------------DILKDQWSPALTISKVLLSI 177 +YP PP V F ++++HPN+ +G +C+ ++ ++W+P T+ ++LSI Sbjct: 66 NYPNSPPTVRFTSEMWHPNVYPDGRVCISIHPPGDDPNGYELASERWTPVHTVESIVLSI 125 Query: 176 CSLLTDPNPDDPLVPEIAHMCKADRTRYESTAR 78 S+L+ PN + P E A + + ++ R Sbjct: 126 ISMLSSPNDESPANIEAAKDWREKQDEFKKKVR 158
>UBE2W_HUMAN (Q96B02) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 317 YPFXPPKVAFKTKVF--HPNINSNGNICLDILKDQWSPALTISKVLLSICSLLT 162 YPF P+V F + HP++ SNG+ICL IL + WSPAL++ V LSI S+L+ Sbjct: 64 YPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117
>UBE2W_BRARE (Q4VBH4) Probable ubiquitin-conjugating enzyme E2 W (EC 6.3.2.19)| (Ubiquitin-protein ligase W) (Ubiquitin carrier protein W) Length = 151 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/54 (50%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = -3 Query: 317 YPFXPPKVAFKTKVF--HPNINSNGNICLDILKDQWSPALTISKVLLSICSLLT 162 YPF P+V F + HP++ SNG+ICL IL + WSPAL++ V LSI S+L+ Sbjct: 64 YPFESPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLS 117
>UBC12_CAEEL (Q9XVK5) NEDD8-conjugating enzyme ubc-12 (EC 6.3.2.-) (NEDD8| protein ligase) (NEDD8 carrier protein) (Ubiquitin-conjugating enzyme E2 12) Length = 180 Score = 54.7 bits (130), Expect = 6e-08 Identities = 32/95 (33%), Positives = 48/95 (50%), Gaps = 7/95 (7%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDILKDQ------WSPALTISKVLLSICSLLT 162 P+Y PP V TKV+HPNIN +G+ICL IL+ W P ++ V+ + SL Sbjct: 85 PEYNNVPPVVKCLTKVWHPNINEDGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFN 144 Query: 161 D-PNPDDPLVPEIAHMCKADRTRYESTARGWTHKY 60 D + +D L + A M +R + R + +Y Sbjct: 145 DLMDFNDALNIQAAQMWSQNRESFNHRVREYISRY 179
>UBE2U_HUMAN (Q5VVX9) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 321 Score = 52.0 bits (123), Expect = 4e-07 Identities = 27/84 (32%), Positives = 49/84 (58%), Gaps = 3/84 (3%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSN-GNICLDIL--KDQWSPALTISKVLLSICSLLTDPNP 150 +Y + PP V F T FHPN++ + G C+D L ++W+ T+S +LL++ +L++P Sbjct: 62 EYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVL 121 Query: 149 DDPLVPEIAHMCKADRTRYESTAR 78 ++P+ E A + D + Y + R Sbjct: 122 ENPVNLEAARILVKDESLYRTILR 145
>UBE2U_MACFA (Q95LM1) Ubiquitin-conjugating enzyme E2 U (EC 6.3.2.19)| (Ubiquitin-protein ligase U) (Ubiquitin carrier protein U) Length = 322 Score = 51.2 bits (121), Expect = 6e-07 Identities = 26/81 (32%), Positives = 48/81 (59%), Gaps = 3/81 (3%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSN-GNICLDILKD--QWSPALTISKVLLSICSLLTDPNP 150 +Y + PP V F T FHPN++ + G C+D L + +W+ T+S +LL++ +L++P Sbjct: 62 EYNYAPPVVKFVTIPFHPNVDPHTGQPCIDFLDNPKKWNTNYTLSSILLALQVMLSNPVL 121 Query: 149 DDPLVPEIAHMCKADRTRYES 87 ++P+ E A + D + Y + Sbjct: 122 ENPVNLEAARILTKDESLYRT 142
>UBCX_YEAST (P29340) Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19)| (Ubiquitin-protein ligase) (Ubiquitin carrier protein) (Peroxin-4) Length = 183 Score = 49.3 bits (116), Expect = 2e-06 Identities = 27/84 (32%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = -3 Query: 317 YPFXPPKVAF-KTKVFHPNINS-NGNICLDILK-DQWSPALTISKVLLSICSLLTDPNPD 147 YP PPK++F + + H N+ S G ICL+ILK ++W+P + + ++ LL +P D Sbjct: 88 YPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCD 147 Query: 146 DPLVPEIAHMCK-ADRTRYESTAR 78 PL +I ++ + D + Y+ + Sbjct: 148 SPLDVDIGNIIRCGDMSAYQGIVK 171
>UBC17_CAEEL (Q11076) Probable ubiquitin-conjugating enzyme protein 17| Length = 679 Score = 45.4 bits (106), Expect = 3e-05 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 12/59 (20%) Frame = -3 Query: 317 YPFXPPKVAFKTKV-----FHPNINSNGNICLDIL-------KDQWSPALTISKVLLSI 177 YPF PPK AF T F+PN+ ++G ICL IL +++W+P ++ +VL+SI Sbjct: 472 YPFSPPKCAFLTTGSGNVRFNPNLYNDGKICLSILGTWEGRPEEKWNPYCSLMQVLVSI 530
>BIRC6_HUMAN (Q9NR09) Baculoviral IAP repeat-containing protein 6| (Ubiquitin-conjugating BIR-domain enzyme apollon) Length = 4829 Score = 37.7 bits (86), Expect = 0.007 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 13/70 (18%) Frame = -3 Query: 320 DYPFXPPKVAFKTKV-----FHPNINSNGNICLDIL-------KDQWSP-ALTISKVLLS 180 DYP PP V +T F+PN+ ++G +CL IL +++W+P + +VL+S Sbjct: 4607 DYPSSPPLVNLETTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQVLVS 4666 Query: 179 ICSLLTDPNP 150 + SL+ P Sbjct: 4667 VQSLILVAEP 4676
>UBC6_SCHPO (O42646) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase ubc6) (Ubiquitin carrier protein ubc6) Length = 227 Score = 36.2 bits (82), Expect = 0.021 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICL---DILKDQWSPALTISKVLLSICSLLT 162 PDYPF PP + T +N +CL D W+P+ +S +L+ + S +T Sbjct: 62 PDYPFKPPAIRMITP--SGRFQTNTRLCLSFSDFHPKSWNPSWMVSTILVGLVSFMT 116
>UBC6_ASHGO (Q74Z34) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 242 Score = 35.8 bits (81), Expect = 0.028 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 3/88 (3%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICL---DILKDQWSPALTISKVLLSICSLLTDPNP 150 DYPF PP + T + N +CL D D W+P+ +++ +L + S +T Sbjct: 63 DYPFNPPAIRMLTP--NGRFRENTRLCLSMSDYHPDTWNPSWSVATILTGLLSFMTTDE- 119 Query: 149 DDPLVPEIAHMCKADRTRYESTARGWTH 66 I M D T+ + A+ H Sbjct: 120 -----SSIGTMESTDSTKRKYAAKSKEH 142
>UB2J2_MOUSE (Q6P073) Ubiquitin-conjugating enzyme E2 J2 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE2) Length = 259 Score = 35.0 bits (79), Expect = 0.047 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILK---DQWSPALTISKVLLSICSLLTDPNP 150 ++PF PP + T + N +CL I D W+PA ++S +L + S + + P Sbjct: 70 EFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127
>UB2J2_HUMAN (Q8N2K1) Ubiquitin-conjugating enzyme E2 J2 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 2) (NCUBE2) Length = 259 Score = 35.0 bits (79), Expect = 0.047 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICLDILK---DQWSPALTISKVLLSICSLLTDPNP 150 ++PF PP + T + N +CL I D W+PA ++S +L + S + + P Sbjct: 70 EFPFKPPSIYMITP--NGRFKCNTRLCLSITDFHPDTWNPAWSVSTILTGLLSFMVEKGP 127
>MMS2_YEAST (P53152) Ubiquitin-conjugating enzyme variant MMS2 (UEV MMS2)| Length = 137 Score = 34.7 bits (78), Expect = 0.062 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 3/59 (5%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNIN-SNGNICLDI--LKDQWSPALTISKVLLSICSLLTDP 156 P+YP PPKV F +K+ P +N + G + D L+D W A T+ +LL + + P Sbjct: 66 PNYPDSPPKVTFISKINLPCVNPTTGEVQTDFHTLRD-WKRAYTMETLLLDLRKEMATP 123
>UBC6_DEBHA (Q6BYG4) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 242 Score = 34.3 bits (77), Expect = 0.080 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 3/56 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICL---DILKDQWSPALTISKVLLSICSLLT 162 +YPF PP ++ T + N +CL D D W+PA +++ +L + S +T Sbjct: 63 EYPFKPPSISMITP--NGRFACNTRLCLSMSDYHPDTWNPAWSVATILTGLLSFMT 116
>5HT2C_MOUSE (P34968) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) (5HT-1C) Length = 459 Score = 33.5 bits (75), Expect = 0.14 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 LQLLFSYIYPMA-YLCVQPLAVDS-YLVRSALHMCAIXXXXXXXXXXXXXXEHIDSRTLD 198 L +L+ Y++P+ YLC +++D + S +H+CAI +SRT Sbjct: 113 LAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAVRSPVEHSRFNSRTKA 172 Query: 199 MVRAGLHWSL 228 +++ + W++ Sbjct: 173 IMKIAIVWAI 182
>5HT2C_RAT (P08909) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) (5HT-1C) Length = 460 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 LQLLFSYIYPMA-YLCVQPLAVDS-YLVRSALHMCAIXXXXXXXXXXXXXXEHIDSRTLD 198 L +L+ Y++P+ YLC +++D + S +H+CAI +SRT Sbjct: 113 LAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKA 172 Query: 199 MVRAGLHWSL 228 +++ + W++ Sbjct: 173 IMKIAIVWAI 182
>5HT2C_PANTR (Q5IS66) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) Length = 458 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 LQLLFSYIYPMA-YLCVQPLAVDS-YLVRSALHMCAIXXXXXXXXXXXXXXEHIDSRTLD 198 L +L+ Y++P+ YLC +++D + S +H+CAI +SRT Sbjct: 112 LAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKA 171 Query: 199 MVRAGLHWSL 228 +++ + W++ Sbjct: 172 IMKIAIVWAI 181
>5HT2C_HUMAN (P28335) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) (5HT-1C) Length = 458 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 LQLLFSYIYPMA-YLCVQPLAVDS-YLVRSALHMCAIXXXXXXXXXXXXXXEHIDSRTLD 198 L +L+ Y++P+ YLC +++D + S +H+CAI +SRT Sbjct: 112 LAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKA 171 Query: 199 MVRAGLHWSL 228 +++ + W++ Sbjct: 172 IMKIAIVWAI 181
>5HT2C_CANFA (Q60F97) 5-hydroxytryptamine 2C receptor (5-HT-2C) (Serotonin| receptor 2C) (5-HT2C) (5-HTR2C) Length = 458 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/70 (24%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = +1 Query: 25 LQLLFSYIYPMA-YLCVQPLAVDS-YLVRSALHMCAIXXXXXXXXXXXXXXEHIDSRTLD 198 L +L+ Y++P+ YLC +++D + S +H+CAI +SRT Sbjct: 112 LAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPVEHSRFNSRTKA 171 Query: 199 MVRAGLHWSL 228 +++ + W++ Sbjct: 172 IMKIAIVWAI 181
>CLAP1_HUMAN (Q7Z460) CLIP-associating protein 1 (Cytoplasmic linker-associated| protein 1) (Multiple asters homolog 1) Length = 1538 Score = 32.7 bits (73), Expect = 0.23 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Frame = -3 Query: 272 HPNINSNGNICLDI---LKDQWSPALTISKVLLSICSLLTDPN 153 H N + ICL + L + LT+SK++ IC+LL DPN Sbjct: 138 HKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPN 180
>UBC6_KLULA (Q6CMG6) Ubiquitin-conjugating enzyme E2 6 (EC 6.3.2.19)| (Ubiquitin-protein ligase UBC6) (Ubiquitin carrier protein UBC6) Length = 251 Score = 32.3 bits (72), Expect = 0.31 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = -3 Query: 320 DYPFXPPKVAFKTKVFHPNINSNGNICL---DILKDQWSPALTISKVLLSICSLLT 162 DYPF PP + T + N +CL D + W+PA ++ +L + S +T Sbjct: 63 DYPFNPPAIRMITP--NGRFKENTRLCLSMSDYHPEAWNPAWSVVTILNGLLSFMT 116
>STP22_YEAST (P25604) Suppressor protein STP22 of temperature-sensitive| alpha-factor receptor and arginine permease (Vacuolar protein sorting-associated protein VPS23) Length = 385 Score = 29.6 bits (65), Expect = 2.0 Identities = 25/75 (33%), Positives = 35/75 (46%), Gaps = 13/75 (17%) Frame = -3 Query: 317 YPFXPPKVAFKTKVFHPN-----------INSNGNICLDILKDQWSP-ALTISKVLLSIC 174 YP PP ++ + F N I+SNG I L IL W P A+ + V+ + Sbjct: 91 YPVKPPFISINLENFDMNTISSSLPIQEYIDSNGWIALPIL-HCWDPAAMNLIMVVQELM 149 Query: 173 SLLTDPNPDD-PLVP 132 SLL +P D P +P Sbjct: 150 SLLHEPPQDQAPSLP 164
>S45A1_HUMAN (Q9Y2W3) Proton-associated sugar transporter A (PAST-A) (Solute| carrier family 45 member 1) (Deleted in neuroblastoma 5 protein) (DNb-5) Length = 782 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/29 (51%), Positives = 16/29 (55%), Gaps = 4/29 (13%) Frame = -2 Query: 177 MLAADGPEPGRPAGAGD----RAHVQGRP 103 ML GP PGR +GD R H QGRP Sbjct: 1 MLQQPGPRPGRQQPSGDRDACRLHPQGRP 29
>UB2V1_HUMAN (Q13404) Ubiquitin-conjugating enzyme E2 variant 1 (UEV-1) (CROC-1)| (Ubiquitin-conjugating enzyme variant Kua) (TRAF6-regulated IKK activator 1 beta Uev1A) Length = 221 Score = 28.9 bits (63), Expect = 3.4 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNI----CLDILKDQWSPALTISKVLLSICSL-LTD 159 P YP PP V F TK+ +NS+ + + +L +W + +I VL + L ++ Sbjct: 147 PKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLA-KWQNSYSIKVVLQELRRLMMSK 205 Query: 158 PNPDDPLVPE 129 N P PE Sbjct: 206 ENMKLPQPPE 215
>DACT1_HUMAN (Q9NYF0) Dapper homolog 1 (hDPR1) (Heptacellular carcinoma novel| gene 3 protein) Length = 836 Score = 28.5 bits (62), Expect = 4.4 Identities = 18/37 (48%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -2 Query: 162 GPE---PGRPAGAGDRAHVQGRPDQVRVHGQGLDAQV 61 GPE PGRPAG G RA R HG G +A V Sbjct: 637 GPEAGVPGRPAGGGHRA-------GSRAHGHGREAVV 666
>HCN4_RABIT (Q9TV66) Potassium/sodium hyperpolarization-activated cyclic| nucleotide-gated channel 4 (Hyperpolarization-activated cation channel 4) (HAC-4) Length = 1175 Score = 28.5 bits (62), Expect = 4.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 207 PHHIQGSAVDMLAADGPEPGRPAGAGDRAHV 115 PH G +V L PGRP GAG HV Sbjct: 1090 PHSSSGESVAALPPFPRAPGRPPGAGPGQHV 1120
>CH602_CORGL (Q8NM64) 60 kDa chaperonin 2 (Protein Cpn60 2) (groEL protein 2)| Length = 548 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 12/57 (21%) Frame = -2 Query: 138 GAGDRAHVQGRPDQVRVHGQGLD------------AQVRHGVDITK*ELQSRIELKD 4 GAG A ++GR +Q+RV + D A++ GV + K + +ELK+ Sbjct: 338 GAGSEAQIEGRVNQIRVEIENSDSDYDREKLNERLAKLAGGVAVLKVGAATEVELKE 394
>UB2J1_MOUSE (Q9JJZ4) Ubiquitin-conjugating enzyme E2 J1 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE1) Length = 318 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDIL---KDQWSPALTISKVLLSICSLL 165 P+YP PP + T + ICL I + W P+ +I LL+I + Sbjct: 66 PEYPMKPPSIILLTA--NGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFM 119
>UB2J1_HUMAN (Q9Y385) Ubiquitin-conjugating enzyme E2 J1 (EC 6.3.2.19)| (Non-canonical ubiquitin-conjugating enzyme 1) (NCUBE1) (Yeast ubiquitin-conjugating enzyme UBC6 homolog E) (HSUBC6e) Length = 318 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 3/56 (5%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNICLDIL---KDQWSPALTISKVLLSICSLL 165 P+YP PP + T + ICL I + W P+ +I LL+I + Sbjct: 66 PEYPMKPPSIILLTA--NGRFEVGKKICLSISGHHPETWQPSWSIRTALLAIIGFM 119
>RECR_ANAMM (Q5PB75) Recombination protein recR| Length = 213 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -2 Query: 204 HHIQGSAVDMLAADGPEPGRPAGAGDRAHVQGRPDQVRVHGQGLDAQV 61 +H+ G A+ L+ GPE G DR G + + +D QV Sbjct: 118 YHVLGGALSALSGIGPEDLNLGGIVDRIRTHGVKEVIVATSNDMDGQV 165
>UB2V2_HUMAN (Q15819) Ubiquitin-conjugating enzyme E2 variant 2 (MMS2)| (Enterocyte differentiation-associated factor EDAF-1) (Enterocyte differentiation-promoting factor) (EDPF-1) (Vitamin D3-inducible protein) (DDVit 1) Length = 144 Score = 27.7 bits (60), Expect = 7.5 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 5/70 (7%) Frame = -3 Query: 323 PDYPFXPPKVAFKTKVFHPNINSNGNI----CLDILKDQWSPALTISKVLLSICSL-LTD 159 P YP PP V F TK+ IN++ + + +L +W + +I VL + L ++ Sbjct: 70 PKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLA-KWQNSYSIKVVLQELRRLMMSK 128 Query: 158 PNPDDPLVPE 129 N P PE Sbjct: 129 ENMKLPQPPE 138
>MDR19_ARATH (Q9LSJ6) Putative multidrug resistance protein 19 (P-glycoprotein| 17) Length = 1240 Score = 27.7 bits (60), Expect = 7.5 Identities = 21/75 (28%), Positives = 33/75 (44%), Gaps = 11/75 (14%) Frame = -3 Query: 266 NINSNGNICLDILKDQ---------WSPALTISKVLLSICSLLTD--PNPDDPLVPEIAH 120 N SN NI + + KDQ +S +I SI + ++D PN + PLVP Sbjct: 601 NEESNVNINVSVTKDQVMSLSKDFKYSQHNSIGSTSSSIVTNVSDLIPNDNQPLVPSFTR 660 Query: 119 MCKADRTRYESTARG 75 + +R ++ G Sbjct: 661 LMVMNRPEWKHALYG 675
>SSA27_HUMAN (O60232) Sjoegren syndrome/scleroderma autoantigen 1 (Autoantigen| p27) Length = 199 Score = 27.3 bits (59), Expect = 9.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 213 PRPHHIQGSAVDMLAADGP 157 PRP H +G+A + AA GP Sbjct: 120 PRPEHCEGAAAGLKAAQGP 138 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 36,212,129 Number of Sequences: 219361 Number of extensions: 644842 Number of successful extensions: 2630 Number of sequences better than 10.0: 177 Number of HSP's better than 10.0 without gapping: 2508 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2565 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
