| Clone Name | rbaal31f07 |
|---|---|
| Clone Library Name | barley_pub |
>MRGRE_MOUSE (Q91ZB7) Mas-related G-protein coupled receptor member E| (Evolutionary breakpoint transcript 3 protein) Length = 310 Score = 28.5 bits (62), Expect = 4.6 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = -3 Query: 207 LSLSLEVSLRSQ*CYRLFCPPWLNFGELRFCTGC*APSAWSLC----L*LAGTCLAVLG 43 + LSL ++ ++ C P W R+ T C W LC L L+G C G Sbjct: 105 VGLSLLAAISTEQCLATLFPAWYLCRRPRYLTTCVCALIWVLCLLLDLLLSGACTQFFG 163
>MRGRE_HUMAN (Q86SM8) Mas-related G-protein coupled receptor member E (G-protein| coupled receptor 167) (Fragment) Length = 145 Score = 28.5 bits (62), Expect = 4.6 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = -3 Query: 207 LSLSLEVSLRSQ*CYRLFCPPWLNFGELRFCTGC*APSAWSLC----L*LAGTCLAVLG 43 + LSL ++ + C P W + R T C W+LC L L+G C G Sbjct: 52 VGLSLLAAVSVEQCLAALFPAWYSCRRPRHLTTCVCALTWALCLLLHLLLSGACTQFFG 110
>MRGRE_MACFA (Q5U9D7) Mas-related G-protein coupled receptor member E| Length = 311 Score = 28.1 bits (61), Expect = 6.0 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 4/59 (6%) Frame = -3 Query: 207 LSLSLEVSLRSQ*CYRLFCPPWLNFGELRFCTGC*APSAWSLC----L*LAGTCLAVLG 43 + LSL V++ + C P W + R T C W+ C L L+G C G Sbjct: 108 VGLSLLVAVSVEQCLAALFPAWYSCRRPRHLTTCVCALTWACCLLLHLLLSGACTQFFG 166
>Y2800_ANASP (Q8YTC2) Hypothetical WD-repeat protein alr2800| Length = 1258 Score = 28.1 bits (61), Expect = 6.0 Identities = 16/50 (32%), Positives = 24/50 (48%) Frame = +1 Query: 43 AQHGQTGACQS*AERPGRWSLTTSAKTQLTKVQPWRTKQSIASLRPQTDF 192 A +G T A P R L + + + K+ W+T + I+SL TDF Sbjct: 931 AWYGNTDWALPVAFSPDRQILASGSNDKTVKLWDWQTGKYISSLEGHTDF 980
>PYHD_NPVMB (P12423) Polyhedrin (Major occlusion protein)| Length = 246 Score = 27.7 bits (60), Expect = 7.8 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +3 Query: 33 LNSSPTRPNRCLPIIGRETRQMEPN 107 +N PTRPNRC + + + +P+ Sbjct: 123 INMRPTRPNRCFKFLAQHALRCDPD 147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,381,335 Number of Sequences: 219361 Number of extensions: 676388 Number of successful extensions: 1541 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1539 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)