| Clone Name | rbaal30o19 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CSN10_CANGA (Q6FVG5) COP9 signalosome complex subunit 10 | 30 | 4.2 | 2 | RPGF5_MOUSE (Q8C0Q9) Rap guanine nucleotide exchange factor 5 (G... | 30 | 5.5 | 3 | MATN1_CHICK (P05099) Cartilage matrix protein precursor (Matrili... | 29 | 9.4 |
|---|
>CSN10_CANGA (Q6FVG5) COP9 signalosome complex subunit 10| Length = 643 Score = 30.4 bits (67), Expect = 4.2 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = -1 Query: 141 LNKFNY--LRAISYSVFINCIMSVYDYIVCLPFHVCHDCFVELRLV 10 +N F+Y LR +F++ + +YD V L H C +EL + Sbjct: 387 INPFDYEQLRIAPDHIFVDKLRRIYDVFVGLQIQEMHSCLIELECI 432
>RPGF5_MOUSE (Q8C0Q9) Rap guanine nucleotide exchange factor 5 (Guanine| nucleotide exchange factor for Rap1) (M-Ras-regulated Rap GEF) (MR-GEF) Length = 814 Score = 30.0 bits (66), Expect = 5.5 Identities = 14/36 (38%), Positives = 23/36 (63%) Frame = +1 Query: 172 LLQHSTYLRQQRRHINIWATRGLLDLGIFSSLETHL 279 LL+H +++ + I +W LLD+GI SS++ HL Sbjct: 72 LLEHCPFVQCRSMAIGVWQL--LLDMGIMSSVDQHL 105
>MATN1_CHICK (P05099) Cartilage matrix protein precursor (Matrilin-1)| Length = 493 Score = 29.3 bits (64), Expect = 9.4 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = -1 Query: 564 CFSLPAYQ*TVCNENITTD*DSSLITMCSGSKGSVIGICY 445 C S P C E T + D + CSG GS + + + Sbjct: 236 CISTPGSYKCACKEGFTLNNDGKTCSACSGGSGSALDLVF 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 70,992,043 Number of Sequences: 219361 Number of extensions: 1242749 Number of successful extensions: 2113 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2083 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2113 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)