ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal31c17 |
|---|---|
| Clone Library Name | barley_pub |
>RBS_HORVU (Q40004) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 174 Score = 52.0 bits (123), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESGKA 203 DNMRQVQCVS IAFKPPGC ESGKA Sbjct: 150 DNMRQVQCVSFIAFKPPGCQESGKA 174
>RBS3_WHEAT (P07398) Ribulose bisphosphate carboxylase small chain clone 512| (EC 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 113 Score = 52.0 bits (123), Expect = 4e-07 Identities = 23/25 (92%), Positives = 23/25 (92%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESGKA 203 DNMRQVQCVS IAFKPPGC ESGKA Sbjct: 89 DNMRQVQCVSFIAFKPPGCEESGKA 113
>RBS2_WHEAT (P26667) Ribulose bisphosphate carboxylase small chain PW9,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PW9) Length = 175 Score = 50.8 bits (120), Expect = 9e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESGKA 203 DNMRQVQCVS IAF+PPGC ESGKA Sbjct: 151 DNMRQVQCVSFIAFRPPGCEESGKA 175
>RBS1_WHEAT (P00871) Ribulose bisphosphate carboxylase small chain PWS4.3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit PWS4.3) Length = 174 Score = 49.7 bits (117), Expect = 2e-06 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESGKA 203 DN+RQVQCVS IAF+PPGC ESGKA Sbjct: 150 DNLRQVQCVSFIAFRPPGCEESGKA 174
>RBS_AEGTA (Q38793) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 175 Score = 45.1 bits (105), Expect = 5e-05 Identities = 21/25 (84%), Positives = 21/25 (84%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESGKA 203 DNMRQVQ VS IA KPPGC ESGKA Sbjct: 151 DNMRQVQSVSFIASKPPGCEESGKA 175
>RBS3_ORYSA (P18567) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 175 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESG 209 DN+RQVQ +S IA+KPPGC ESG Sbjct: 151 DNVRQVQLISFIAYKPPGCEESG 173
>RBS2_ORYSA (P18566) Ribulose bisphosphate carboxylase small chain A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit A) Length = 175 Score = 41.6 bits (96), Expect = 5e-04 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESG 209 DN+RQVQ +S IA+KPPGC ESG Sbjct: 151 DNVRQVQLISFIAYKPPGCEESG 173
>RBS3_AMAHP (Q9XGX4) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 180 Score = 37.4 bits (85), Expect = 0.010 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN RQVQCVS IAFKPPG Sbjct: 162 DNKRQVQCVSFIAFKPPG 179
>RBS1_SOYBN (P00865) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 178 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KPPG Sbjct: 160 DNVRQVQCISFIAYKPPG 177
>RBS2_PETHY (P04715) Ribulose bisphosphate carboxylase small chain SSU11A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU11A) Length = 180 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KPPG Sbjct: 162 DNVRQVQCISFIAYKPPG 179
>RBS1_PETHY (P04714) Ribulose bisphosphate carboxylase small chain SSU8,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU8) Length = 180 Score = 36.6 bits (83), Expect = 0.017 Identities = 14/18 (77%), Positives = 17/18 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KPPG Sbjct: 162 DNVRQVQCISFIAYKPPG 179
>RBS_MANES (Q42915) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 35.8 bits (81), Expect = 0.029 Identities = 13/18 (72%), Positives = 17/18 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S +A+KPPG Sbjct: 164 DNVRQVQCISFLAYKPPG 181
>RBS3B_ARATH (P10798) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 181 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXES 212 DN RQVQC+S IA+KPP E+ Sbjct: 160 DNTRQVQCISFIAYKPPSFTEA 181
>RBS2B_ARATH (P10797) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 181 Score = 35.0 bits (79), Expect = 0.050 Identities = 14/22 (63%), Positives = 17/22 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXES 212 DN RQVQC+S IA+KPP E+ Sbjct: 160 DNTRQVQCISFIAYKPPSFTEA 181
>RBS_GLYTO (Q42822) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 34.3 bits (77), Expect = 0.085 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN+RQVQC+S IA+KPP Sbjct: 160 DNVRQVQCISFIAYKPP 176
>RBS_GLYTA (Q42823) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 34.3 bits (77), Expect = 0.085 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN+RQVQC+S IA+KPP Sbjct: 160 DNVRQVQCISFIAYKPP 176
>RBS4_SOYBN (P12468) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 34.3 bits (77), Expect = 0.085 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN+RQVQC+S IA+KPP Sbjct: 160 DNVRQVQCISFIAYKPP 176
>RBS_MAIZE (P05348) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 170 Score = 34.3 bits (77), Expect = 0.085 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN++Q QCVS IA+KPPG Sbjct: 151 DNIKQTQCVSFIAYKPPG 168
>RBS1B_ARATH (P10796) Ribulose bisphosphate carboxylase small chain 1B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1B) Length = 181 Score = 33.9 bits (76), Expect = 0.11 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXES 212 DN RQVQC+S IA+KPP ++ Sbjct: 160 DNTRQVQCISFIAYKPPSFTDA 181
>RBS_PYRPY (P24007) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 165 DNVRQVQCISFIAYKPAG 182
>RBS_MALSP (Q02980) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 165 DNVRQVQCISFIAYKPAG 182
>RBS_SINAL (P13951) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) (Fragment) Length = 82 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXES 212 DN RQVQC+S IA+KPP ++ Sbjct: 61 DNNRQVQCISFIAYKPPSFTDA 82
>RBS_RAPSA (P08135) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/22 (59%), Positives = 17/22 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXES 212 DN RQVQC+S IA+KPP ++ Sbjct: 160 DNNRQVQCISFIAYKPPSFTDA 181
>RBS3_SOLTU (P32764) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 163 DNVRQVQCISFIAYKPEG 180
>RBS2_NICSY (P22433) Ribulose bisphosphate carboxylase small chain S41,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit S41) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 163 DNVRQVQCISFIAYKPEG 180
>RBS1_SOLTU (P26574) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 163 DNVRQVQCISFIAYKPEG 180
>RBS1_LYCES (P08706) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) (LESS17) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 163 DNVRQVQCISFIAYKPEG 180
>RBS0_SOLTU (P10647) Ribulose bisphosphate carboxylase small chain C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit C) Length = 181 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 163 DNVRQVQCISFIAYKPEG 180
>RBS_TOBAC (P69249) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) (TSSU3-8) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBSC_SOLTU (P26577) Ribulose bisphosphate carboxylase small chain 2C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2C) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBSB_SOLTU (P26576) Ribulose bisphosphate carboxylase small chain 2B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2B) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBSA_SOLTU (P26575) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS8_NICPL (P26573) Ribulose bisphosphate carboxylase small chain 8B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 8B) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS3B_LYCES (P05349) Ribulose bisphosphate carboxylase small chain 3B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3B) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS3A_LYCES (P07180) Ribulose bisphosphate carboxylase small chain 3A/3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A/3C) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS2A_LYCES (P07179) Ribulose bisphosphate carboxylase small chain 2A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2A) (LESS 5) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS1_NICSY (P69250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 162 DNVRQVQCISFIAYKPEG 179
>RBS1A_ARATH (P10795) Ribulose bisphosphate carboxylase small chain 1A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1A) Length = 180 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN RQVQC+S IA+KPP Sbjct: 160 DNTRQVQCISFIAYKPP 176
>RBS_GOSHI (P31333) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/18 (72%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA+KP G Sbjct: 164 DNVRQVQCISFIAYKPKG 181
>RBS_FAGCR (O22077) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 33.5 bits (75), Expect = 0.14 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN RQVQC+S IA+KPP Sbjct: 164 DNKRQVQCISFIAYKPP 180
>RBS1_AMAHP (Q42516) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 183 Score = 33.1 bits (74), Expect = 0.19 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN RQVQCVS IA+KP G Sbjct: 164 DNKRQVQCVSFIAYKPAG 181
>RBS_LACSA (Q40250) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S I KPPG Sbjct: 162 DNIRQVQCISFIVAKPPG 179
>RBS2_BRANA (P27985) Ribulose bisphosphate carboxylase small chain F1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit F1) Length = 181 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN RQVQC+S IA+KPP Sbjct: 160 DNNRQVQCISFIAYKPP 176
>RBS1_BRANA (P05346) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 181 Score = 33.1 bits (74), Expect = 0.19 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPP 227 DN RQVQC+S IA+KPP Sbjct: 160 DNNRQVQCISFIAYKPP 176
>RBS_HEVBR (P29684) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 183 Score = 32.7 bits (73), Expect = 0.25 Identities = 12/18 (66%), Positives = 16/18 (88%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S +A+KP G Sbjct: 164 DNVRQVQCISFLAYKPKG 181
>RBS_MUSAC (O24045) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 32.3 bits (72), Expect = 0.32 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN RQVQC+S IA+KP G Sbjct: 162 DNNRQVQCISFIAYKPTG 179
>RBS1_ORYSA (P05347) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 172 Score = 32.3 bits (72), Expect = 0.32 Identities = 15/23 (65%), Positives = 18/23 (78%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPGCXESG 209 DN+RQVQ +S IA+ PGC ESG Sbjct: 149 DNVRQVQLISFIAYN-PGCEESG 170
>RBS4_MESCR (Q08184) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 183 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS IA+KP Sbjct: 163 DNVRQVQCVSFIAYKP 178
>RBS_FLATR (P07089) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 173 Score = 32.0 bits (71), Expect = 0.42 Identities = 14/18 (77%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQCVS IA KP G Sbjct: 155 DNVRQVQCVSFIASKPTG 172
>RBS_BETVE (Q96542) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 182 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN RQVQ +S IA+KPPG Sbjct: 164 DNKRQVQIISFIAYKPPG 181
>RBS5_MESCR (Q08185) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 182 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS IA+KP Sbjct: 162 DNVRQVQCVSFIAYKP 177
>RBS6_MESCR (Q08186) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 186 Score = 32.0 bits (71), Expect = 0.42 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS IA+KP Sbjct: 166 DNVRQVQCVSFIAYKP 181
>RBS3_MESCR (Q08183) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 183 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 163 DNVRQVQCISFIAYKP 178
>RBS4_FLAPR (Q39746) Ribulose bisphosphate carboxylase small chain 4,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 4) Length = 178 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 160 DNVRQVQCISFIASKPDG 177
>RBS2_FLAPR (Q39744) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 178 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 160 DNVRQVQCISFIASKPEG 177
>RBS_CUCSA (P08474) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 164 DNVRQVQCISFIAYKP 179
>RBS7_FLAPR (Q39749) Ribulose bisphosphate carboxylase small chain 7,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 7) Length = 173 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 155 DNVRQVQCISFIASKPDG 172
>RBS5_FLAPR (Q39747) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 173 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 155 DNVRQVQCISFIASKPDG 172
>RBS3_FLAPR (Q39745) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 173 Score = 31.6 bits (70), Expect = 0.55 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 155 DNVRQVQCISFIASKPDG 172
>RBS_STELP (Q41351) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 162 DNVRQVQCISFIAYKP 177
>RBS2_MESCR (Q04450) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 160 DNVRQVQCISFIAYKP 175
>RBS_CAPAN (O65349) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 187 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 162 DNVRQVQCISFIAYKP 177
>RBS1_MESCR (P16032) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 182 Score = 31.6 bits (70), Expect = 0.55 Identities = 12/16 (75%), Positives = 15/16 (93%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA+KP Sbjct: 162 DNVRQVQCISFIAYKP 177
>RBS1_FLAPR (Q39743) Ribulose bisphosphate carboxylase small chain 1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 1) Length = 173 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+S IA KP G Sbjct: 155 DNVRQVQCISFIASKPGG 172
>RBS2_AMAHP (Q9XGX5) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 184 Score = 31.2 bits (69), Expect = 0.72 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQCVS IA+KP Sbjct: 165 DNKRQVQCVSFIAYKP 180
>RBS2_SPIOL (Q43832) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 180 Score = 30.8 bits (68), Expect = 0.94 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 D+ RQVQCVS IA+KP G Sbjct: 162 DSNRQVQCVSFIAYKPAG 179
>RBS1_LEMGI (P00872) Ribulose bisphosphate carboxylase small chain SSU1,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU1) Length = 173 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 157 DNKRQVQCISFIAYKP 172
>RBS_SILPR (P18960) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS6_LEMGI (P19312) Ribulose bisphosphate carboxylase small chain SSU5B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5B) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS5_LEMGI (P19311) Ribulose bisphosphate carboxylase small chain SSU5A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU5A) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS4_LEMGI (P19310) Ribulose bisphosphate carboxylase small chain SSU40B,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40B) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS3_LEMGI (P19309) Ribulose bisphosphate carboxylase small chain SSU40A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU40A) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS2_LEMGI (P19308) Ribulose bisphosphate carboxylase small chain SSU26,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit SSU26) Length = 177 Score = 30.8 bits (68), Expect = 0.94 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN RQVQC+S IA+KP Sbjct: 161 DNKRQVQCISFIAYKP 176
>RBS_ZANAE (O48550) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN RQVQC+S + +KP G Sbjct: 160 DNTRQVQCISFLTYKPEG 177
>KE4_PONPY (Q5RFD5) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTH 89 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTH 89 H H H H+H S++ H+HGH+H Sbjct: 60 HAHGHG-HTHESIWHGHTHGHDHGHSH 85
>KE4_HUMAN (Q92504) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 30.4 bits (67), Expect = 1.2 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTH 89 H HSHR HSH H HGHTH Sbjct: 43 HGHSHR-HSHEDFHHGHSHAHGHGHTH 68 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTH 89 H H H H+H S++ H+HGH+H Sbjct: 60 HAHGHG-HTHESIWHGHTHDHDHGHSH 85
>RBS6_FLAPR (Q39748) Ribulose bisphosphate carboxylase small chain 6,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 6) Length = 173 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA KP Sbjct: 155 DNVRQVQCISFIASKP 170
>AMGO2_PONPY (Q5R7M3) Amphoterin-induced protein 2 precursor (AMIGO-2)| Length = 522 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 121 SIYLSYLFLRICVCPCSCTNMARENML 41 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>AMGO2_HUMAN (Q86SJ2) Amphoterin-induced protein 2 precursor (AMIGO-2)| (Alivin-1) (Differentially expressed in gastric adenocarcinomas) (DEGA) Length = 522 Score = 29.3 bits (64), Expect = 2.7 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 121 SIYLSYLFLRICVCPCSCTNMARENML 41 SI L L+L + CPC C ++NML Sbjct: 409 SIVLVLLYLYLTPCPCKCKTKRQKNML 435
>HNF1B_XENLA (Q91910) Hepatocyte nuclear factor 1-beta (HNF-1B) (LFB3) (XLFB3)| Length = 561 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +3 Query: 3 YVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 101 Y H H Q+SHTS F AM+V + L N Sbjct: 517 YAHKHEPPQYSHTSRFPSAMVVTDTSSISTLSN 549
>SRCH_HUMAN (P23327) Sarcoplasmic reticulum histidine-rich calcium-binding| protein precursor Length = 699 Score = 29.3 bits (64), Expect = 2.7 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRN 101 H+ SHR HSH ++ EH H HILR+ Sbjct: 151 HLPSHRSHSHQDEDEDEVVSSEH-HHHILRH 180
>ENGC_PROMA (Q7VEJ4) Probable GTPase engC (EC 3.6.1.-)| Length = 309 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = +2 Query: 80 TYTYS*EQIRKINGEGKPKAMSELTKLQWHFICGPSSV 193 T+ Y I +NGEG K + L ++ +CGPS V Sbjct: 156 TWGYQPIPISIVNGEGIQKLSARLKSMKLGVLCGPSGV 193
>RBS_HELAN (P08705) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 178 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 DN+RQVQC+ IA +P G Sbjct: 160 DNVRQVQCIMFIASRPDG 177
>RBS_PINTH (P10053) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 171 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S I KP Sbjct: 155 DNVRQVQCISFIVHKP 170
>RBS_LARLA (P16031) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 189 Score = 28.5 bits (62), Expect = 4.6 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S I KP Sbjct: 171 DNVRQVQCISFIVHKP 186
>KE4_CANFA (Q5TJF6) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 469 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTH 89 H HSHR+ SH H HGHTH Sbjct: 43 HGHSHRR-SHEDFHHGHSYAHGHGHTH 68
>ZIP1_ARATH (O81123) Zinc transporter 1 precursor (ZRT/IRT-like protein 1)| Length = 355 Score = 28.5 bits (62), Expect = 4.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 3 YVHIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK 104 +VHIH+H H HT HG T ++R + Sbjct: 176 HVHIHTHASHGHT-----------HGSTELIRRR 198
>BUD3_ASHGO (Q9HF61) Bud site selection protein BUD3| Length = 1478 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 9 HIHSHRQHSHTSMFSRAMLVHEHGHTHILRNK*ER*MEKENPKQ 140 H +++ S+ S H++G HILRN E E+P+Q Sbjct: 818 HKKDKKENKRNSVGSDTRNRHDNGSVHILRNSSSSFRELESPRQ 861
>RBS5_FRIAG (O22645) Ribulose bisphosphate carboxylase small chain 5,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 5) Length = 179 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS I KP Sbjct: 163 DNVRQVQCVSFIVEKP 178
>RBS3_FRIAG (O22573) Ribulose bisphosphate carboxylase small chain 3,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3) Length = 179 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS I KP Sbjct: 163 DNVRQVQCVSFIVEKP 178
>RBS2_FRIAG (O22572) Ribulose bisphosphate carboxylase small chain 2,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 2) Length = 179 Score = 28.1 bits (61), Expect = 6.1 Identities = 12/16 (75%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQCVS I KP Sbjct: 163 DNVRQVQCVSFIVEKP 178
>KE4_MOUSE (Q31125) Zinc transporter SLC39A7 (Solute carrier family 39 member| 7) (Histidine-rich membrane protein Ke4) Length = 476 Score = 28.1 bits (61), Expect = 6.1 Identities = 13/29 (44%), Positives = 14/29 (48%), Gaps = 2/29 (6%) Frame = +3 Query: 9 HIHSHRQ--HSHTSMFSRAMLVHEHGHTH 89 H HSH H H+ S H HGHTH Sbjct: 47 HGHSHEDFHHGHSHGHSHEDFHHGHGHTH 75
>RBS_MEDSA (O65194) Ribulose bisphosphate carboxylase small chain, chloroplast| precursor (EC 4.1.1.39) (RuBisCO small subunit) Length = 180 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA P Sbjct: 162 DNVRQVQCISFIAHTP 177
>RBS3_PEA (P07689) Ribulose bisphosphate carboxylase small chain 3A,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3A) Length = 180 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA P Sbjct: 162 DNVRQVQCISFIAHTP 177
>RBS2_PEA (P00869) Ribulose bisphosphate carboxylase small chain 3C,| chloroplast precursor (EC 4.1.1.39) (RuBisCO small subunit 3C) (PSS15) Length = 180 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKP 230 DN+RQVQC+S IA P Sbjct: 162 DNVRQVQCISFIAHTP 177
>RBS1_SPIOL (P00870) Ribulose bisphosphate carboxylase small chain (EC| 4.1.1.39) (RuBisCO small subunit) Length = 123 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -3 Query: 277 DNMRQVQCVSXIAFKPPG 224 ++ R+VQC+S IA+KP G Sbjct: 105 NDKREVQCISFIAYKPAG 122 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,623,358 Number of Sequences: 219361 Number of extensions: 673487 Number of successful extensions: 1804 Number of sequences better than 10.0: 96 Number of HSP's better than 10.0 without gapping: 1682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1789 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
