| Clone Name | rbaal30m05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MT3_CARPA (Q96386) Metallothionein-like protein type 3 (MT-3) | 61 | 2e-09 | 2 | MT3_MUSAC (Q40256) Metallothionein-like protein type 3 (MT-3) (M... | 60 | 3e-09 | 3 | MT3_MALDO (O24059) Metallothionein-like protein type 3 (MT-3) | 56 | 7e-08 | 4 | MT3_ACTCH (P43389) Metallothionein-like protein type 3 PKIWI503 | 55 | 1e-07 | 5 | MT3_PRUAV (O48951) Metallothionein-like protein 1 (MT-1) | 49 | 7e-06 | 6 | MT3_PICGL (Q40854) Metallothionein-like protein EMB30 | 44 | 3e-04 | 7 | FBX15_HUMAN (Q8NCQ5) F-box only protein 15 | 29 | 7.4 | 8 | MUC13_RAT (P97881) Mucin-13 precursor | 29 | 9.6 |
|---|
>MT3_CARPA (Q96386) Metallothionein-like protein type 3 (MT-3)| Length = 65 Score = 60.8 bits (146), Expect = 2e-09 Identities = 29/47 (61%), Positives = 34/47 (72%), Gaps = 3/47 (6%) Frame = -3 Query: 486 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLEV---HETAEND 355 M+D CGNCDCADKTQCVKKG SY +++TEKS + V AEND Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAEND 47
>MT3_MUSAC (Q40256) Metallothionein-like protein type 3 (MT-3) (MWMT3)| Length = 65 Score = 60.5 bits (145), Expect = 3e-09 Identities = 27/44 (61%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = -3 Query: 474 CGNCDCADKTQCVKKGDSYGIVMVDTEKSHLE----VHETAEND 355 CGNCDC DK+QCVKKG+SYGI +V+TEKS+++ E AE+D Sbjct: 4 CGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHD 47
>MT3_MALDO (O24059) Metallothionein-like protein type 3 (MT-3)| Length = 66 Score = 55.8 bits (133), Expect = 7e-08 Identities = 22/36 (61%), Positives = 29/36 (80%) Frame = -3 Query: 486 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLE 379 M+ KC NCDCAD TQCVKKG+SY +V+V+TE ++ Sbjct: 1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMD 36
>MT3_ACTCH (P43389) Metallothionein-like protein type 3 PKIWI503| Length = 63 Score = 55.5 bits (132), Expect = 1e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -3 Query: 486 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLE 379 M+DKCGNCDCAD +QCVKKG+S I +V+T+KS++E Sbjct: 1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIE 34
>MT3_PRUAV (O48951) Metallothionein-like protein 1 (MT-1)| Length = 64 Score = 49.3 bits (116), Expect = 7e-06 Identities = 18/36 (50%), Positives = 27/36 (75%) Frame = -3 Query: 486 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLE 379 M+ KC NCDC+D +QC KKG S+ +V+V+TE ++ Sbjct: 1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMD 36
>MT3_PICGL (Q40854) Metallothionein-like protein EMB30| Length = 60 Score = 43.9 bits (102), Expect = 3e-04 Identities = 20/35 (57%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = -3 Query: 486 MADKCGNCDCADKTQCVKKGDSY-GIVMVDTEKSH 385 M+ CGNCDCADK+QC KKG GIV E H Sbjct: 1 MSSDCGNCDCADKSQCTKKGFQIDGIVETSYEMGH 35
>FBX15_HUMAN (Q8NCQ5) F-box only protein 15| Length = 434 Score = 29.3 bits (64), Expect = 7.4 Identities = 19/68 (27%), Positives = 32/68 (47%), Gaps = 14/68 (20%) Frame = +2 Query: 353 SSFSAVSCTSKW--LFSVSTMTMP*LSPFFTHWV------------LSAQSQLPHLSAMD 490 +S + + KW L S+ST+ + ++P FT W L A+ L HL+ Sbjct: 146 TSVTVIWYGKKWPCLASLSTLDLCGMTPVFTDWYKTPTKHRLRWHSLIAKYNLSHLTIST 205 Query: 491 VLACDRRV 514 ++ CDR + Sbjct: 206 MIGCDRLI 213
>MUC13_RAT (P97881) Mucin-13 precursor| Length = 547 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/35 (37%), Positives = 16/35 (45%) Frame = -3 Query: 522 SRGTLRSQAKTSMADKCGNCDCADKTQCVKKGDSY 418 S T+ S + T D C + C CVK DSY Sbjct: 198 SSSTVTSSSSTGSNDPCNSNPCKSPASCVKLYDSY 232 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,491,777 Number of Sequences: 219361 Number of extensions: 928201 Number of successful extensions: 2433 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2432 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)