| Clone Name | rbaal31a16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIR1_ARATH (Q9SJ20) Ribonucleoside-diphosphate reductase large s... | 32 | 1.7 | 2 | CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 p... | 30 | 8.7 |
|---|
>RIR1_ARATH (Q9SJ20) Ribonucleoside-diphosphate reductase large subunit (EC| 1.17.4.1) (Ribonucleoside-diphosphate reductase R1 subunit) (AtRNR1) Length = 816 Score = 32.0 bits (71), Expect = 1.7 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 19/145 (13%) Frame = -3 Query: 659 DFGDFRFLHIKPKAVRYVSGVATAILGSGEFSAAEFKEAKVDPISQFSTPIAGHM-NKDH 483 + G + ++ + + Y S TA+ + F K P+ +AG + +K+ Sbjct: 419 NLGTIKSSNLCTEIIEYTSPTETAVCNLASIALPRFVREKGVPLDSHPPKLAGSLDSKNR 478 Query: 482 ADDTKLIVQHSTSVKVDFASIVDVD---------------SLGINVKAGYDGTVLKLRIP 348 D + + + + +V V+ I+DV+ +GI V+ D +L L +P Sbjct: 479 YFDFEKLAEVTATVTVNLNKIIDVNYYPVETAKTSNMRHRPIGIGVQGLADAFIL-LGMP 537 Query: 347 F--PRRAQDRKDV-KTLIVEMLQAA 282 F P Q KD+ +T+ L+A+ Sbjct: 538 FDSPEAQQLNKDIFETIYYHALKAS 562
>CD34_CANFA (Q28270) Hematopoietic progenitor cell antigen CD34 precursor| Length = 389 Score = 29.6 bits (65), Expect = 8.7 Identities = 15/30 (50%), Positives = 20/30 (66%) Frame = +3 Query: 36 NSSVQIYKSLCISLSLTGSNAHKFAVTMEP 125 NSSVQ SL I++S T +N +VT+EP Sbjct: 107 NSSVQSQTSLAITVSFTPTNFSTSSVTLEP 136 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,609,981 Number of Sequences: 219361 Number of extensions: 1824365 Number of successful extensions: 4989 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4988 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)