| Clone Name | rbaal30l03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1660_MYCLE (O69468) Hypothetical protein ML1660 | 35 | 0.26 | 2 | Y2951_MYCBO (P65058) Hypothetical protein Mb2951c | 32 | 2.2 | 3 | Y2926_MYCTU (P65057) Hypothetical protein Rv2926c/MT2996 | 32 | 2.2 | 4 | RAD50_METMA (Q8PUY4) DNA double-strand break repair rad50 ATPase | 30 | 6.5 | 5 | ASF1_HELAN (P22357) Anther-specific protein SF18 precursor (Frag... | 30 | 6.5 | 6 | TRI25_HUMAN (Q14258) Tripartite motif protein 25 (Zinc finger pr... | 30 | 8.5 |
|---|
>Y1660_MYCLE (O69468) Hypothetical protein ML1660| Length = 217 Score = 34.7 bits (78), Expect = 0.26 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = -1 Query: 502 IDISKNLRDIIHLEITLDVFCSSTCKGLCLVCGANL 395 ID+ +++ D + +E+ C S C GLC CG +L Sbjct: 143 IDLEQSIIDAVGIELPFAPMCRSDCPGLCAECGTSL 178
>Y2951_MYCBO (P65058) Hypothetical protein Mb2951c| Length = 207 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 511 EKEIDISKNLRDIIHLEITLDVFCSSTCKGLCLVCGANL 395 ++ ID+ + + D + LE+ C C GLC CG L Sbjct: 136 DETIDLEQPIIDAVGLELPFSPVCRPDCPGLCPQCGVPL 174
>Y2926_MYCTU (P65057) Hypothetical protein Rv2926c/MT2996| Length = 207 Score = 31.6 bits (70), Expect = 2.2 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -1 Query: 511 EKEIDISKNLRDIIHLEITLDVFCSSTCKGLCLVCGANL 395 ++ ID+ + + D + LE+ C C GLC CG L Sbjct: 136 DETIDLEQPIIDAVGLELPFSPVCRPDCPGLCPQCGVPL 174
>RAD50_METMA (Q8PUY4) DNA double-strand break repair rad50 ATPase| Length = 1070 Score = 30.0 bits (66), Expect = 6.5 Identities = 23/72 (31%), Positives = 35/72 (48%) Frame = -1 Query: 532 RLHFPAGEKEIDISKNLRDIIHLEITLDVFCSSTCKGLCLVCGANLNTSSCSCSTEEPQA 353 RLH EKE++++ LR+I E TL +G C CG L S +C+ EE + Sbjct: 524 RLH--GKEKELEVT--LREI---ENTLRKNRELLAEGKCPTCGQELKGSGIACTAEECEE 576 Query: 352 KDARRPGTMKDL 317 K + + D+ Sbjct: 577 KKEKLSLELADI 588
>ASF1_HELAN (P22357) Anther-specific protein SF18 precursor (Fragment)| Length = 161 Score = 30.0 bits (66), Expect = 6.5 Identities = 14/27 (51%), Positives = 16/27 (59%) Frame = -3 Query: 539 G*PPAFPGRGEGDRHLEEPSGHHPPGD 459 G PPA PG+GEGD P+ P GD Sbjct: 82 GTPPAPPGKGEGDAPHPPPTPSPPGGD 108
>TRI25_HUMAN (Q14258) Tripartite motif protein 25 (Zinc finger protein 147)| (Estrogen-responsive finger protein) (Efp) (RING finger protein 147) Length = 630 Score = 29.6 bits (65), Expect = 8.5 Identities = 19/73 (26%), Positives = 30/73 (41%) Frame = -1 Query: 418 CLVCGANLNTSSCSCSTEEPQAKDARRPGTMKDLLKPMQSRL**CRQCICRHLVTCVIVF 239 CLVC A+ + P +D ++DLL+ S+ R+ C C+ Sbjct: 119 CLVCMASFCQEHLQPHFDSPAFQDHPLQPPVRDLLRRKCSQHNRLREFFCPEHSECICHI 178 Query: 238 RIVMSKICSPVKM 200 +V K CSP + Sbjct: 179 CLVEHKTCSPASL 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,361,144 Number of Sequences: 219361 Number of extensions: 1551353 Number of successful extensions: 4341 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4199 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4336 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6427774254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)