| Clone Name | rbaal30k20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FADJ_PHOPR (Q6LTK3) Fatty acid oxidation complex alpha subunit [... | 30 | 4.6 | 2 | NCKX1_RAT (Q9QZM6) Sodium/potassium/calcium exchanger 1 (Na(+)/K... | 29 | 7.8 |
|---|
>FADJ_PHOPR (Q6LTK3) Fatty acid oxidation complex alpha subunit [Includes:| Enoyl-CoA hydratase (EC 4.2.1.17); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)] Length = 715 Score = 30.0 bits (66), Expect = 4.6 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 3/101 (2%) Frame = -1 Query: 438 ITSLDELKTKVGHVIVMILLVKMFERSKMVKITTGLDLLSYSVCIFLSSASLYILHNLHR 259 IT LDE+ +G I ILL ++ ER K + DLL S + L+N + Sbjct: 546 ITLLDEVGVDIGAKISPILLAELGERFKAPDV---FDLLLSDDRKGRKSGKGFYLYNTKK 602 Query: 258 PEHEESVMPHL*LNRASRSS-DAMASWCSCRLVSD--RCID 145 E ++SV L L +++ +A C+ ++++ RC+D Sbjct: 603 KEVDKSVYKLLSLEPEQKAAGQDIALRCTLMMLNEAARCLD 643
>NCKX1_RAT (Q9QZM6) Sodium/potassium/calcium exchanger 1| (Na(+)/K(+)/Ca(2+)-exchange protein 1) (Retinal rod Na-Ca+K exchanger) Length = 1181 Score = 29.3 bits (64), Expect = 7.8 Identities = 19/69 (27%), Positives = 30/69 (43%) Frame = -3 Query: 553 RAVHQQRVQRSAFRIRPGSARIVAVRDVRSEGEAEVDEDHVPGRAQDQGWARHRDDPAGE 374 R + Q + + S+ P V V + E + D++ PG +D A HR D GE Sbjct: 667 RVLPQTKAESSSDEEEPAELPAVTVTPAPAP-EDKGDQEEDPGCQEDVDEAEHRGDMTGE 725 Query: 373 DVRAEQDGE 347 + E + E Sbjct: 726 EGERETEAE 734 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,212,320 Number of Sequences: 219361 Number of extensions: 1430985 Number of successful extensions: 4437 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4436 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)