| Clone Name | rbaal30k19 |
|---|---|
| Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 43.5 bits (101), Expect = 3e-04 Identities = 24/60 (40%), Positives = 26/60 (43%), Gaps = 5/60 (8%) Frame = -3 Query: 387 CCNNCR-SFSGVDVCDDAHPQCPTGCSACRVVT----TNPQTFRCADMKATVDGTCGGPC 223 CC NC SFSG+ CDD C C C V + FRC D T G CG C Sbjct: 46 CCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPKC 102
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 36.2 bits (82), Expect = 0.054 Identities = 16/47 (34%), Positives = 19/47 (40%), Gaps = 5/47 (10%) Frame = -3 Query: 387 CCNNCRSFSGVD-----VCDDAHPQCPTGCSACRVVTTNPQTFRCAD 262 CCN C VC D CP C++C +NP RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSCVCTRSNPPQCRCTD 57
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 32.0 bits (71), Expect = 1.0 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = +2 Query: 236 QVPSTVAFMSAQRNVWGFVV---TTRHAEQPVGHCGWASSQTST 358 Q+P T FMSA N + ++ TT E P G+ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>LAMA5_HUMAN (O15230) Laminin alpha-5 chain precursor| Length = 3695 Score = 30.8 bits (68), Expect = 2.3 Identities = 19/59 (32%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Frame = -3 Query: 378 NCRSFS-GVDVCDDAHPQC-------PTGCSACRVVTTNPQTFRCADMKATVDGTCGGP 226 NCR G +CD+ QC P C C+ PQTF C + + C GP Sbjct: 1480 NCRPCDCGARLCDELTGQCICPPRTIPPDCLLCQ-----PQTFGCHPLVGCEECNCSGP 1533
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 30.8 bits (68), Expect = 2.3 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -2 Query: 466 ARGDSDPPGRPGHGSPLARERRLFPH 389 A G PPG PG G+ L ++ +FPH Sbjct: 1753 APGGYGPPGMPGGGAQLVKKELIFPH 1778
>IBBA_PEA (Q41065) Seed trypsin/chymotrypsin inhibitor IVA precursor (PSTI| IVA) (TI12-36) [Contains: Seed trypsin/chymotrypsin inhibitor I (PSTI I)] (Fragment) Length = 96 Score = 30.8 bits (68), Expect = 2.3 Identities = 13/37 (35%), Positives = 16/37 (43%) Frame = -3 Query: 345 DDAHPQCPTGCSACRVVTTNPQTFRCADMKATVDGTC 235 DD C C C +NP T RC D++ T C Sbjct: 26 DDVKSAC---CDTCLCTKSNPPTCRCVDVRETCHSAC 59 Score = 29.3 bits (64), Expect = 6.6 Identities = 14/50 (28%), Positives = 20/50 (40%), Gaps = 3/50 (6%) Frame = -3 Query: 402 DYFPTCCNNC---RSFSGVDVCDDAHPQCPTGCSACRVVTTNPQTFRCAD 262 D CC+ C +S C D C + C +C +NP +C D Sbjct: 27 DVKSACCDTCLCTKSNPPTCRCVDVRETCHSACDSCICAYSNPPKCQCFD 76
>PRIA_LENED (Q01200) Protein priA precursor| Length = 258 Score = 30.4 bits (67), Expect = 3.0 Identities = 13/37 (35%), Positives = 20/37 (54%) Frame = -3 Query: 339 AHPQCPTGCSACRVVTTNPQTFRCADMKATVDGTCGG 229 A P CP G AC + ++ + C D A ++ +CGG Sbjct: 176 AVPACPKGLDACPIAGSSLGDYECLDTSAELE-SCGG 211
>YBBO_ECOLI (P0AFP4) Hypothetical oxidoreductase ybbO (EC 1.-.-.-)| Length = 269 Score = 30.4 bits (67), Expect = 3.0 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +2 Query: 293 VTTRHAEQPVGHCGWASSQTSTPEKDLQLLQHVGK*SAFTCE----RTPMTRTAWRIRIA 460 V +++PV + G A+ T PE + ++H AF E R P+T W + + Sbjct: 200 VNQTQSDKPVENPGIAARFTLGPEAVVDKVRH-----AFISEKPKMRYPVTLVTWAVMVL 254 Query: 461 ASLVPFMVADELL 499 L+P V D++L Sbjct: 255 KRLLPGRVMDKIL 267
>YBBO_ECOL6 (P0AFP5) Hypothetical oxidoreductase ybbO (EC 1.-.-.-)| Length = 269 Score = 30.4 bits (67), Expect = 3.0 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +2 Query: 293 VTTRHAEQPVGHCGWASSQTSTPEKDLQLLQHVGK*SAFTCE----RTPMTRTAWRIRIA 460 V +++PV + G A+ T PE + ++H AF E R P+T W + + Sbjct: 200 VNQTQSDKPVENPGIAARFTLGPEAVVDKVRH-----AFISEKPKMRYPVTLVTWAVMVL 254 Query: 461 ASLVPFMVADELL 499 L+P V D++L Sbjct: 255 KRLLPGRVMDKIL 267
>MT_ASTFL (P55951) Metallothionein (MT)| Length = 58 Score = 30.4 bits (67), Expect = 3.0 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 3/59 (5%) Frame = -3 Query: 387 CCNNCRSFSGVDVCDDAHPQCPTG--CSACRVVTTNPQTFRC-ADMKATVDGTCGGPCK 220 CCN DVC+ A C TG C++CR + T C K TC PC+ Sbjct: 5 CCN--------DVCECAAGGCKTGCVCTSCRCSPCDKCTSGCKCPSKEECAKTCSKPCE 55
>IBB_MEDSC (P80321) Bowman-Birk type proteinase inhibitor (MSTI)| Length = 62 Score = 30.4 bits (67), Expect = 3.0 Identities = 14/46 (30%), Positives = 20/46 (43%), Gaps = 3/46 (6%) Frame = -3 Query: 387 CCNNC---RSFSGVDVCDDAHPQCPTGCSACRVVTTNPQTFRCADM 259 CC+ C RS C D +C + C +C + P RC D+ Sbjct: 8 CCDFCPCTRSIPPQCQCTDVREKCHSACKSCLCTRSFPPQCRCYDI 53
>IBB_DOLBI (Q9S9E3) Horsegram inhibitor 1 (Horsegram inhibitor I) (Bowman-Birk| type proteinase inhibitor HGI-I) [Contains: Horsegram germinated inhibitor 1 (Horsegram germinated inhibitor I) (HGGI-I); Horsegram germinated inhibitor 2 (Horsegram germinated Length = 76 Score = 30.4 bits (67), Expect = 3.0 Identities = 18/60 (30%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = -3 Query: 387 CCNNCRSFSGVDV---CDDAH-PQCPTGCSACRVVTTNPQTFRCADMKATVDGTCGGPCK 220 CC+ C + C D C + CS+C + P C DMK C PCK Sbjct: 16 CCDQCTCTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVDMK----DFCYAPCK 71
>IBB3_DOLAX (P01057) Bowman-Birk type proteinase inhibitor DE-3| Length = 76 Score = 30.4 bits (67), Expect = 3.0 Identities = 18/60 (30%), Positives = 23/60 (38%), Gaps = 4/60 (6%) Frame = -3 Query: 387 CCNNCRSFSGVDV---CDDAH-PQCPTGCSACRVVTTNPQTFRCADMKATVDGTCGGPCK 220 CC+ C + C D C + CS+C + P C DMK C PCK Sbjct: 16 CCDECACTKSIPPQCRCTDVRLNSCHSACSSCVCTFSIPAQCVCVDMK----DFCYAPCK 71
>IBBWT_MEDSA (P16346) Bowman-Birk type wound-induced trypsin inhibitor| Length = 58 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/46 (32%), Positives = 18/46 (39%), Gaps = 3/46 (6%) Frame = -3 Query: 387 CCNNC---RSFSGVDVCDDAHPQCPTGCSACRVVTTNPQTFRCADM 259 CCN C RS C D C + C C + P CAD+ Sbjct: 4 CCNFCPCTRSIPPQCRCTDIGETCHSACKTCLCTKSIPPQCHCADI 49
>IBB_LENCU (Q8W4Y8) Bowman-Birk type proteinase inhibitor precursor| (Trypsin/chymotrypsin inhibitor) Length = 110 Score = 30.0 bits (66), Expect = 3.9 Identities = 15/50 (30%), Positives = 19/50 (38%), Gaps = 3/50 (6%) Frame = -3 Query: 402 DYFPTCCNNC---RSFSGVDVCDDAHPQCPTGCSACRVVTTNPQTFRCAD 262 D CC+ C RS C D C + C C +NP +C D Sbjct: 45 DVKSACCDTCLCTRSQPPTCRCVDVRESCHSACDKCVCAYSNPPQCQCYD 94
>MVHD_METTH (Q50781) F420-non-reducing hydrogenase iron-sulfur subunit D (EC| 1.12.99.-) (Methyl viologen-reducing hydrogenase delta subunit) (MVH subunit D) Length = 140 Score = 29.6 bits (65), Expect = 5.0 Identities = 27/86 (31%), Positives = 35/86 (40%), Gaps = 11/86 (12%) Frame = -3 Query: 387 CCNNCRSFSGVDVCDDAHPQCPTGCSACRVVTT---NPQ----TFRCADMKATVDGTCGG 229 CCN C S+ G D A Q PT RV+ + PQ FR V G G Sbjct: 11 CCNWC-SYGGADTAGTARMQYPTNIRVIRVMCSGRIEPQFVLKAFREGADGVLVTGCHHG 69 Query: 228 PCK----KY*SAQAHMRLLFRLAPKI 163 C Y MRL+++LA ++ Sbjct: 70 DCHYDAGNY-KLDRRMRLIYKLADEL 94
>LAMA5_MOUSE (Q61001) Laminin alpha-5 chain precursor| Length = 3718 Score = 29.6 bits (65), Expect = 5.0 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 8/59 (13%) Frame = -3 Query: 378 NCRSFS-GVDVCDDAHPQC-------PTGCSACRVVTTNPQTFRCADMKATVDGTCGGP 226 NCR G +CD+ QC P C C+ PQ+F C + + C GP Sbjct: 1485 NCRPCDCGARLCDELTGQCICPPRTVPPDCLVCQ-----PQSFGCHPLVGCEECNCSGP 1538
>IBBB_PEA (P56679) Seed trypsin/chymotrypsin inhibitor IVB (PSTI-IVB)| [Contains: Seed trypsin/chymotrypsin inhibitor II (PSTI II)] Length = 72 Score = 29.3 bits (64), Expect = 6.6 Identities = 13/37 (35%), Positives = 15/37 (40%) Frame = -3 Query: 345 DDAHPQCPTGCSACRVVTTNPQTFRCADMKATVDGTC 235 DD C C C +NP T RC D+ T C Sbjct: 2 DDVKSAC---CDTCLCTKSNPPTCRCVDVGETCHSAC 35
>PCSK5_BRACL (Q9NJ15) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC6-like) (aPC6) Length = 1696 Score = 29.3 bits (64), Expect = 6.6 Identities = 18/55 (32%), Positives = 20/55 (36%) Frame = -3 Query: 399 YFPTCCNNCRSFSGVDVCDDAHPQCPTGCSACRVVTTNPQTFRCADMKATVDGTC 235 Y TC C D D C GC AC N T C + +A DG C Sbjct: 954 YQGTCHVTCPPGLYGDTTDQVCKACAPGCIACDGPADNQCTL-CEEERAPTDGRC 1007
>LRP1_CHICK (P98157) Low-density lipoprotein receptor-related protein 1 precursor| (LRP) (Alpha-2-macroglobulin receptor) (A2MR) Length = 4543 Score = 29.3 bits (64), Expect = 6.6 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 3/42 (7%) Frame = -3 Query: 384 CNNCRSFSGVDVCDDAHPQCPTGC---SACRVVTTNPQTFRC 268 CNN R S + VCD A C G S CR+ T + +F+C Sbjct: 2739 CNNHRCISKLWVCDGA-DDCGDGSDEDSRCRLTTCSTGSFQC 2779
>FER2_SULTO (P58331) Zinc-containing ferredoxin-2| Length = 103 Score = 28.9 bits (63), Expect = 8.6 Identities = 11/28 (39%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 502 HEEFISNHEGHQARGDSDPPGRPG-HGS 422 + + + HEGH+ G +PPG+ G HG+ Sbjct: 9 NRQVVGEHEGHKIYGPVEPPGKLGIHGT 36
>RS4_METTH (O26142) 30S ribosomal protein S4P| Length = 171 Score = 28.9 bits (63), Expect = 8.6 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 6/49 (12%) Frame = +2 Query: 65 ETTVTKTRRNSIHIVG----HTHTHRQDESGHLIRAFIL--GAKRNNSL 193 ET V + RR++ +++G HT R+ GHL+R IL GAK + L Sbjct: 45 ETMVRRYRRDARYLLGMASEHTGKEREQLLGHLVRTGILNEGAKLEDVL 93 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,018,024 Number of Sequences: 219361 Number of extensions: 1457062 Number of successful extensions: 4555 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 4074 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4550 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)