ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal30k03 |
|---|---|
| Clone Library Name | barley_pub |
>NOTC1_HUMAN (P46531) Neurogenic locus notch homolog protein 1 precursor (Notch 1)| (hN1) (Translocation-associated notch protein TAN-1) [Contains: Notch 1 extracellular truncation; Notch 1 intracellular domain] Length = 2556 Score = 32.0 bits (71), Expect = 0.40 Identities = 21/52 (40%), Positives = 26/52 (50%) Frame = -3 Query: 311 DENTGKSEVNVIXAKTMSADPGGGRRAAEPGSLRFPRLLRQRGTTGTSTSIG 156 D + G +NV M+A GGGR A E G PRL +GTST +G Sbjct: 2240 DTHLGIGHLNVAAKPEMAALGGGGRLAFETGP---PRLSHLPVASGTSTVLG 2288
>COX1_PLABE (O99252) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 476 Score = 32.0 bits (71), Expect = 0.40 Identities = 15/29 (51%), Positives = 18/29 (62%) Frame = +2 Query: 98 YTTVCXAYFSSFGITHSSSHLCLLMYQLF 184 + +C S+FGITHSSS LCLL F Sbjct: 326 FNWLCTYMSSNFGITHSSSLLCLLFICTF 354
>AKR1_SCHPO (Q09701) Palmitoyltransferase akr1 (EC 2.3.1.-) (Ankyrin| repeat-containing protein akr1) Length = 642 Score = 31.2 bits (69), Expect = 0.68 Identities = 14/44 (31%), Positives = 24/44 (54%) Frame = +1 Query: 22 RXITQCTNIRGEILAIYLSXT*MVSIYYRMXCVFFFIWYHSLLF 153 + IT C + +I+ YL + I+ +FF++W HSLL+ Sbjct: 296 KYITTCIHANIDIVHFYLETPFLAGIF---SSIFFWVWCHSLLY 336
>KTHY_MYCMS (Q6MUI5) Thymidylate kinase (EC 2.7.4.9) (dTMP kinase)| Length = 213 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 2/36 (5%) Frame = +2 Query: 167 LMYQLFLVDEEGVETVRNPVRQ--LDDRHRDQQTWS 268 L YQ+ + E G E + +RQ LD+++RD W+ Sbjct: 27 LNYQVLITREPGGEAIAEQIRQIILDNKNRDMDAWT 62
>CENG1_RAT (Q8CGU4) Centaurin-gamma 1 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer) (PIKE) Length = 1186 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 254 DPGGGRRAAEPGSLRFPRLLRQRGTTGTSTS 162 DPG R A EPG R RL ++ STS Sbjct: 51 DPGSPRGAEEPGKKRHERLFHRQDALWISTS 81
>CENG1_HUMAN (Q99490) Centaurin-gamma 1 (ARF-GAP with GTP-binding protein-like,| ankyrin repeat and pleckstrin homology domains 2) (AGAP-2) (Phosphatidylinositol-3-kinase enhancer) (PIKE) (GTP-binding and GTPase activating protein 2) (GGAP2) Length = 1192 Score = 28.1 bits (61), Expect = 5.8 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -3 Query: 254 DPGGGRRAAEPGSLRFPRLLRQRGTTGTSTS 162 DPG R A EPG R RL ++ STS Sbjct: 51 DPGSPRGAEEPGKKRHERLFHRQDALWISTS 81
>KLF2_HUMAN (Q9Y5W3) Krueppel-like factor 2 (Lung krueppel-like factor)| Length = 355 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = -3 Query: 281 VIXAKTMSADPGGGRRAAEPGSLRFPRLLRQRGTTGTSTS 162 ++ A+ AD GGG A PG R PR L++ G G + S Sbjct: 120 LVKAEPPEADGGGGYGCA-PGLTRGPRGLKREGAPGPAAS 158
>UL88_HHV7J (P52364) Protein U59| Length = 347 Score = 28.1 bits (61), Expect = 5.8 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 18 VSXNYSMYKYSRGNTSNLFIXYINGVNILPYV 113 + +Y + YS N NLF Y+N ++LPY+ Sbjct: 292 IDVSYKILSYST-NMMNLFSQYLNFTDLLPYI 322
>PYRG_METAC (Q8TKW5) CTP synthase (EC 6.3.4.2) (UTP--ammonia ligase) (CTP| synthetase) Length = 534 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/54 (29%), Positives = 25/54 (46%) Frame = -3 Query: 308 ENTGKSEVNVIXAKTMSADPGGGRRAAEPGSLRFPRLLRQRGTTGTSTSIGVKR 147 +N K EVN++ A+T+ DP + + + P RGT G +I R Sbjct: 316 DNGCKVEVNMVEAETLEEDPAEIEKLRQFDGILIPGGFGGRGTEGKMLAIKFAR 369
>KERA_COTJA (Q9DE66) Keratocan precursor (KTN) (Keratan sulfate proteoglycan| keratocan) Length = 353 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 158 LCLLMYQLFLVDEEGVETVRNPVRQLDDRHRDQQTWSWHXSHSLQICLC 304 +C + LFLV TVR +LD H WS + Q C C Sbjct: 6 VCPSLLLLFLVHSVWTRTVRQVYNELDPEH-----WSHYTFECPQECFC 49
>KERA_CHICK (O42235) Keratocan precursor (KTN) (Keratan sulfate proteoglycan| keratocan) Length = 353 Score = 27.7 bits (60), Expect = 7.5 Identities = 16/49 (32%), Positives = 20/49 (40%) Frame = +2 Query: 158 LCLLMYQLFLVDEEGVETVRNPVRQLDDRHRDQQTWSWHXSHSLQICLC 304 +C + LFLV TVR +LD H WS + Q C C Sbjct: 6 VCPSLLLLFLVHSVWTRTVRQVYNELDPEH-----WSHYTFECPQECFC 49
>FRAT2_MOUSE (Q8K025) GSK-3-binding protein FRAT2 (Frat-2)| Length = 231 Score = 27.3 bits (59), Expect = 9.8 Identities = 14/29 (48%), Positives = 18/29 (62%) Frame = -3 Query: 260 SADPGGGRRAAEPGSLRFPRLLRQRGTTG 174 SA PG GRR PGS+ R+ ++R T G Sbjct: 136 SALPGPGRRGWLPGSVASHRIQQRRWTAG 164
>SYT5_RAT (P47861) Synaptotagmin-5 (Synaptotagmin V) (SytV) (Synaptotagmin| IX) Length = 386 Score = 27.3 bits (59), Expect = 9.8 Identities = 18/40 (45%), Positives = 20/40 (50%), Gaps = 8/40 (20%) Frame = +1 Query: 220 PGSAARRPPPGSADM--------VLAXITFTSDLPVFSSC 315 PGS A PP S+ + VLA I S L VFSSC Sbjct: 8 PGSPAPETPPDSSRIRQGAVPAWVLATILLGSGLLVFSSC 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,981,556 Number of Sequences: 219361 Number of extensions: 789014 Number of successful extensions: 2060 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 2004 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2060 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
