| Clone Name | rbaal30i23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinas... | 31 | 4.2 | 2 | SCNAA_XENLA (P51167) Amiloride-sensitive sodium channel alpha-su... | 30 | 9.3 |
|---|
>CD2L7_HUMAN (Q9NYV4) Cell division cycle 2-related protein kinase 7 (EC| 2.7.11.22) (CDC2-related protein kinase 7) (Cdc2-related kinase, arginine/serine-rich) (CrkRS) Length = 1490 Score = 30.8 bits (68), Expect = 4.2 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 1/126 (0%) Frame = +2 Query: 44 SNLEPTFRSTHPTHSTYSNTTEYRKQTHNATQTQPQPGHRVRRPGDTTFVLPQVSFSLFL 223 S + + ST P ST+S T+ Q ++ QP V+ T +P + S Sbjct: 574 SQVPASSTSTLPP-STHSKTSAVSSQANS----QPPVQVSVKTQVSVTAAIPHLKTSTLP 628 Query: 224 PIPMIP-L*GGVFRAKQTETGMMIVRRQQEKKEELGEPNYLTRFPAPAFGDRSFMNPHVS 400 P+P+ P L GG ET + + +K++E + LT P P ++P Sbjct: 629 PLPLPPLLPGGDDMDSPKET---LPSKPVKKEKEQRTRHLLTDLPLPPELPGGDLSP--- 682 Query: 401 PDSPGP 418 PDSP P Sbjct: 683 PDSPEP 688
>SCNAA_XENLA (P51167) Amiloride-sensitive sodium channel alpha-subunit| (Epithelial Na+ channel alpha subunit) (Alpha ENaC) (Nonvoltage-gated sodium channel 1 alpha subunit) (SCNEA) (Alpha NaCH) Length = 632 Score = 29.6 bits (65), Expect = 9.3 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 284 MMIVRRQQEKKEELGEPNYLTRFPAPAFGDRSFMNPHV 397 M+++ R KK GE + PAPAF D PH+ Sbjct: 540 MILLHRYYYKKANEGEETTVVPTPAPAFADLEQQVPHI 577 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,757,843 Number of Sequences: 219361 Number of extensions: 1425767 Number of successful extensions: 3684 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3683 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7026286028 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)