| Clone Name | rbaal30h14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-ass... | 31 | 1.0 | 2 | LANC2_MOUSE (Q9JJK2) LanC-like protein 2 (Testis-specific adriam... | 28 | 5.0 | 3 | EDG4_HUMAN (Q9HBW0) Lysophosphatidic acid receptor Edg-4 (LPA re... | 28 | 6.5 |
|---|
>RIMB1_HUMAN (O95153) Peripheral-type benzodiazepine receptor-associated protein| 1 (PRAX-1) (Peripheral benzodiazepine receptor-interacting protein) (PBR-IP) (RIM-binding protein 1) (RIM-BP1) Length = 1857 Score = 30.8 bits (68), Expect = 1.0 Identities = 20/44 (45%), Positives = 25/44 (56%) Frame = +2 Query: 41 GPLHVVMHSLQHSRSSTIVLLMHMAV*CRDRVVPSDLLYHRADA 172 GPLH+ + +L SR S+ L +AV R VVPS L HR A Sbjct: 853 GPLHISVQALT-SRGSSDPLRCCLAVGARAGVVPSQLRVHRLTA 895
>LANC2_MOUSE (Q9JJK2) LanC-like protein 2 (Testis-specific adriamycin| sensitivity protein) Length = 450 Score = 28.5 bits (62), Expect = 5.0 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 7/49 (14%) Frame = +2 Query: 41 GPLHV---VMHSLQHSRSS----TIVLLMHMAV*CRDRVVPSDLLYHRA 166 GPL V + H L+ S T +L MH + C++ +P +LLY RA Sbjct: 153 GPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELLYGRA 201
>EDG4_HUMAN (Q9HBW0) Lysophosphatidic acid receptor Edg-4 (LPA receptor 2)| (LPA-2) Length = 351 Score = 28.1 bits (61), Expect = 6.5 Identities = 13/32 (40%), Positives = 22/32 (68%) Frame = +1 Query: 22 LKRQFKRTLTCSYAQLTTFKIVHYCTTNAHGG 117 ++R F+R L C+ + +T + VHY T++A GG Sbjct: 302 MRRTFRRLLCCACLRQSTRESVHY-TSSAQGG 332 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,070,170 Number of Sequences: 219361 Number of extensions: 436606 Number of successful extensions: 719 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 715 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 719 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)