| Clone Name | rbaal30h03 |
|---|---|
| Clone Library Name | barley_pub |
>LDLR_RAT (P35952) Low-density lipoprotein receptor precursor (LDL receptor)| Length = 879 Score = 30.0 bits (66), Expect = 5.2 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 Query: 543 NLNLIRSQLSGDPTYDVEWTNGTSYIFDSASCRTIRLPVGVLPPDWLHGAVY 388 N + S LS Y GTS +D+ + P G L DW+HG +Y Sbjct: 439 NNRIYWSDLSQRKIYSAVMDQGTSLSYDAIISGDLHAPDG-LAVDWIHGNIY 489
>Y169_METJA (Q57633) Hypothetical ATP-binding protein MJ0169| Length = 263 Score = 29.6 bits (65), Expect = 6.7 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +1 Query: 490 LHVVGRVAGELAADEVQVTAAGPVVVEVDE 579 L+ VGR GE+ DE+++ G V+VEV E Sbjct: 170 LNRVGRDFGEMGRDEIEMLIKGKVLVEVPE 199
>METE_VIBPA (Q87NA1) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 760 Score = 29.6 bits (65), Expect = 6.7 Identities = 19/62 (30%), Positives = 29/62 (46%) Frame = -2 Query: 543 NLNLIRSQLSGDPTYDVEWTNGTSYIFDSASCRTIRLPVGVLPPDWLHGAVYLGRETTDG 364 N + I + S D T++V W I ++ PV + P +L YLG+E +G Sbjct: 123 NYHYIVPEFSKDDTFEVSWPQLFEEINEAVQAGHKVKPVLLGPVSYL----YLGKEVEEG 178 Query: 363 FD 358 FD Sbjct: 179 FD 180
>TRXR2_HUMAN (Q9NNW7) Thioredoxin reductase 2, mitochondrial precursor (EC| 1.8.1.9) (TR3) (TR-beta) (Selenoprotein Z) (SelZ) Length = 524 Score = 29.3 bits (64), Expect = 8.8 Identities = 17/47 (36%), Positives = 22/47 (46%) Frame = -2 Query: 486 TNGTSYIFDSASCRTIRLPVGVLPPDWLHGAVYLGRETTDGFDCHLW 346 ++GT ++ A R RLP G L W G+E T FD LW Sbjct: 270 SHGTRFLRGCAPSRVRRLPDGQLQVTWEDSTT--GKEDTGTFDTVLW 314
>LAMB_ECOLI (P02943) Maltoporin precursor (Maltose-inducible porin) (Lambda| receptor protein) Length = 446 Score = 29.3 bits (64), Expect = 8.8 Identities = 17/42 (40%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = +2 Query: 326 QTKSTLVQRWQSKPSVVSRPR*T-----APWSQSGGRTPTGN 436 Q K TL Q+WQ+ S+ SRP A W + G TGN Sbjct: 367 QYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEKWGYDYTGN 408 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,454,802 Number of Sequences: 219361 Number of extensions: 1067197 Number of successful extensions: 3281 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3281 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5101629520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)