| Clone Name | rbaal30c21 |
|---|---|
| Clone Library Name | barley_pub |
>VS48_BRSV (P22051) Satellite RNA 48 kDa protein| Length = 424 Score = 29.6 bits (65), Expect = 1.9 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +1 Query: 196 GEITVPSFSLPLFTRYQHARIREHFWP 276 G++T+ FSLPL R+Q ++ H P Sbjct: 158 GKVTLSQFSLPLINRFQEIQLTTHLEP 184
>RNS1D_RATTI (Q8VD85) Ribonuclease pancreatic delta-type precursor (EC 3.1.27.5)| (RNase 1 delta) Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 339 HFISRCEGKPLVPCRCDAA 283 H I CEG PLVP DA+ Sbjct: 131 HIIIACEGNPLVPVHYDAS 149
>RNS1D_RATRT (Q8VD86) Ribonuclease pancreatic delta-type precursor (EC 3.1.27.5)| (RNase 1 delta) Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -3 Query: 339 HFISRCEGKPLVPCRCDA 286 H I CEG PLVP DA Sbjct: 131 HIIIACEGNPLVPVHLDA 148
>RNS1D_RATEX (Q8VD92) Ribonuclease pancreatic delta-type precursor (EC 3.1.27.5)| (RNase 1 delta) Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 339 HFISRCEGKPLVPCRCDAA 283 H I CEG PLVP DA+ Sbjct: 131 HIIIACEGNPLVPVHYDAS 149
>RNS1D_RAT (Q8VD88) Ribonuclease pancreatic delta-type precursor (EC 3.1.27.5)| (RNase 1 delta) Length = 150 Score = 27.3 bits (59), Expect = 9.5 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -3 Query: 339 HFISRCEGKPLVPCRCDAA 283 H I CEG PLVP DA+ Sbjct: 131 HIIIACEGNPLVPVHFDAS 149
>ACEA_YARLI (P41555) Isocitrate lyase (EC 4.1.3.1) (Isocitrase) (Isocitratase)| (ICL) Length = 540 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/48 (25%), Positives = 24/48 (50%) Frame = +1 Query: 181 PKLQXGEITVPSFSLPLFTRYQHARIREHFWPRGGGVTAARNQGLSLA 324 P L+ + ++ ++ AR+RE ++ GG A N+G++ A Sbjct: 339 PALEARALAARLLGKDIYFNWEAARVREGYYRYQGGTQCAVNRGIAYA 386 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,868,702 Number of Sequences: 219361 Number of extensions: 818839 Number of successful extensions: 1867 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1844 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1864 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)