| Clone Name | rbaal30a20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TPSNR_PONPY (Q5R8H1) Tapasin-related protein precursor (TAPASIN-... | 29 | 2.9 | 2 | MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domai... | 28 | 8.4 | 3 | IE63_SHV21 (P13199) 52 kDa immediate-early phosphoprotein | 28 | 8.4 | 4 | MSC3_CANGA (Q6FX33) Meiotic sister-chromatid recombination prote... | 28 | 8.4 |
|---|
>TPSNR_PONPY (Q5R8H1) Tapasin-related protein precursor (TAPASIN-R)| (Tapasin-like) (TAP-binding protein-related protein) (TAPBP-R) (TAP-binding protein-like) Length = 468 Score = 29.3 bits (64), Expect = 2.9 Identities = 16/35 (45%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = +3 Query: 117 RGPL-YGWRKGAADAVTSGARSTPGRSXMPRNASM 218 RG L Y W G AV GA P + M RNAS+ Sbjct: 234 RGQLVYSWTTGQGQAVRKGATLEPEQLGMARNASL 268
>MEGF8_HUMAN (Q7Z7M0) Multiple epidermal growth factor-like domains 8 (EGF-like| domain-containing protein 4) (Multiple EGF-like domain protein 4) Length = 2386 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 111 PPRGPLYGWRKGAADAVTSGARSTPGRSXMPR 206 PP P G +GA D +GA S PG PR Sbjct: 2075 PPPPPADGGPRGAGDPGGAGASSGPGAPAEPR 2106
>IE63_SHV21 (P13199) 52 kDa immediate-early phosphoprotein| Length = 417 Score = 27.7 bits (60), Expect = 8.4 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 181 VERAPEVTASAAPFRQPYNGPRGGNRA*VPPHRRRTPIMLYKFLLDLL 38 V A + PFR+PY+ PR G PP R P +L F + +L Sbjct: 112 VREAAAQRRPSRPFRKPYSHPRNGPLRNGPP---RAPPLLKLFDISIL 156
>MSC3_CANGA (Q6FX33) Meiotic sister-chromatid recombination protein 3| Length = 834 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 Query: 102 ARLPPRGPLYGWRKGAADAVTSGARSTPGRSXMPRNAS 215 AR PP G Y R A ++TS +R R AS Sbjct: 78 ARQPPAGRTYSLRSDRASSITSNSRRPAAGKAQVRRAS 115 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,507,767 Number of Sequences: 219361 Number of extensions: 404356 Number of successful extensions: 1218 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1216 length of database: 80,573,946 effective HSP length: 48 effective length of database: 70,044,618 effective search space used: 1681070832 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)