| Clone Name | rbaal29n22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CLK1_HUMAN (P49759) Dual specificity protein kinase CLK1 (EC 2.7... | 28 | 7.4 | 2 | UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA... | 27 | 9.7 |
|---|
>CLK1_HUMAN (P49759) Dual specificity protein kinase CLK1 (EC 2.7.12.1)| (CDC-like kinase 1) Length = 484 Score = 27.7 bits (60), Expect = 7.4 Identities = 22/90 (24%), Positives = 35/90 (38%) Frame = -2 Query: 274 ENILSYCEFVVALPCQGSCTKVSTYVRTYDDALHLPCISRMQTYXHAWNICYSFDGSGLL 95 +N+ YCE S +V ++ T D C+ ++ + H +IC F+ GL Sbjct: 194 KNVDRYCE------AARSEIQVLEHLNTTDPNSTFRCVQMLEWFEHHGHICIVFELLGLS 247 Query: 94 XVCVHFTWGFXAFFFVVIKTCVIXLCWCVN 5 GF F I+ +C VN Sbjct: 248 TYDFIKENGFLPFRLDHIRKMAYQICKSVN 277
>UL52_EBV (P03193) Helicase/primase complex protein (Probable DNA replication| protein BSLF1) Length = 874 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 212 SKHVRTYVRRRXALAMHITHANVRTRMEHLLFXRWIGSP 96 ++H+RTY R LA H+ ++ RME W P Sbjct: 312 AEHMRTYFTRETYLAEHVRVQQLKIRMEPPAPYTWDPDP 350 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,647,300 Number of Sequences: 219361 Number of extensions: 876376 Number of successful extensions: 1728 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1708 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1728 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)