| Clone Name | rbaal29m10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPO14_YEAST (P36126) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Chol... | 32 | 1.5 |
|---|
>SPO14_YEAST (P36126) Phospholipase D1 (EC 3.1.4.4) (PLD 1) (Choline phosphatase| 1) (Phosphatidylcholine-hydrolyzing phospholipase D1) (Meiosis-specific sporulation-specific protein 14) Length = 1380 Score = 32.3 bits (72), Expect = 1.5 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +3 Query: 165 LNYLSHKWIKMNVSRIKIRLDMSRHSSQKKDMSRHKSSSI 284 L YLSHK + R+K DM RH S + +R+ S+S+ Sbjct: 1108 LQYLSHKLDERKTQRLKKIKDMRRHLSSSTESTRNGSNSL 1147 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 106,164,890 Number of Sequences: 219361 Number of extensions: 2240257 Number of successful extensions: 4843 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4842 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7309604013 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)