| Clone Name | rbaal29j22 |
|---|---|
| Clone Library Name | barley_pub |
>GILT_HUMAN (P13284) Gamma-interferon-inducible lysosomal thiol reductase| precursor (Gamma-interferon-inducible protein IP-30) Length = 261 Score = 61.2 bits (147), Expect = 2e-09 Identities = 28/67 (41%), Positives = 39/67 (58%) Frame = -2 Query: 565 PSLSWKCYNSEHGHKLSLKYGKQTDALVPPHKYVPWVVVDGEPLYEDYENFEAYVCKAYK 386 P +C + G +L ++TDAL PPH+YVPWV V+G+PL ED VC+ Y+ Sbjct: 183 PDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTVNGKPL-EDQTQLLTLVCQLYQ 241 Query: 385 GHPPKIC 365 G P +C Sbjct: 242 GKKPDVC 248
>YKJ2_CAEEL (P34276) Hypothetical protein C02D5.2| Length = 323 Score = 35.4 bits (80), Expect = 0.11 Identities = 15/58 (25%), Positives = 30/58 (51%) Frame = -2 Query: 550 KCYNSEHGHKLSLKYGKQTDALVPPHKYVPWVVVDGEPLYEDYENFEAYVCKAYKGHP 377 +C + G +L G++T +L P ++PW+V++G + + VC+A + P Sbjct: 255 ECASGTRGRRLLALSGQKTASLTPAIDFIPWIVINGSRNSDALYDLTQNVCEAMQPMP 312
>TT8_ARATH (Q9FT81) TRANSPARENT TESTA 8 protein (Basic helix-loop-helix| protein 42) (bHLH42) (AtbHLH042) Length = 518 Score = 31.6 bits (70), Expect = 1.6 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 194 SHISV*ELRKETYNLSIAISRHHLNLVIELEIARVVGDTVAYLHHL 331 SH+ R+E N R + V +++ ++GDT+AY++HL Sbjct: 363 SHVVAERRRREKLNEKFITLRSMVPFVTKMDKVSILGDTIAYVNHL 408
>CAC1B_RABIT (Q05152) Voltage-dependent N-type calcium channel alpha-1B subunit| (Voltage-gated calcium channel alpha subunit Cav2.2) (Calcium channel, L type, alpha-1 polypeptide isoform 5) (Brain calcium channel III) (BIII) Length = 2339 Score = 31.6 bits (70), Expect = 1.6 Identities = 25/65 (38%), Positives = 29/65 (44%), Gaps = 8/65 (12%) Frame = +1 Query: 301 R*HRCLPPPPVVRLGSHGPALGKSWE------DGPCTPCRRKLQSSRNP--RRAARHQPP 456 R HR P P G GPA G E GP C R+ +SS P R ARH+ P Sbjct: 941 RAHRHGPDP-----GKEGPASGTRGERRARHRTGP-RACPREAESSEEPARRHRARHKAP 994 Query: 457 PMERT 471 P + T Sbjct: 995 PTQET 999
>NOS3_PIG (Q28969) Nitric-oxide synthase, endothelial (EC 1.14.13.39)| (EC-NOS) (NOS type III) (NOSIII) (Endothelial NOS) (eNOS) (Constitutive NOS) (cNOS) Length = 1204 Score = 31.2 bits (69), Expect = 2.1 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 8/48 (16%) Frame = +1 Query: 367 KSWEDGPCTPCR--------RKLQSSRNPRRAARHQPPPMERTCAEAQ 486 +S +DGPCTP R RKLQS +P PPP E+ ++A+ Sbjct: 88 QSQQDGPCTPRRCLGSLVLPRKLQSRPSP------GPPPAEQLLSQAR 129
>SRRM1_PONPY (Q5R5Q2) Serine/arginine repetitive matrix protein 1| Length = 917 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 325 PPVVRLGSHGPALGKSWEDGPCTPCRRKLQSSRNPRRAARHQPPPMERT 471 PP+ R S P K P P +R+ S P+R H PPP +R+ Sbjct: 612 PPIQRRYSPSPP-PKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRS 659
>SRRM1_MOUSE (Q52KI8) Serine/arginine repetitive matrix protein 1| (Plenty-of-prolines 101) Length = 946 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 325 PPVVRLGSHGPALGKSWEDGPCTPCRRKLQSSRNPRRAARHQPPPMERT 471 PP+ R S P K P P +R+ S P+R H PPP +R+ Sbjct: 617 PPIQRRYSPSPP-PKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRS 664
>SRRM1_HUMAN (Q8IYB3) Serine/arginine repetitive matrix protein 1| (Ser/Arg-related nuclear matrix protein) (SR-related nuclear matrix protein of 160 kDa) (SRm160) Length = 904 Score = 31.2 bits (69), Expect = 2.1 Identities = 17/49 (34%), Positives = 23/49 (46%) Frame = +1 Query: 325 PPVVRLGSHGPALGKSWEDGPCTPCRRKLQSSRNPRRAARHQPPPMERT 471 PP+ R S P K P P +R+ S P+R H PPP +R+ Sbjct: 598 PPIQRRYSPSPP-PKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRS 645
>CCL27_MOUSE (Q9Z1X0) Small inducible cytokine A27 precursor (CCL27) (CC| chemokine ILC) (IL-11 R-alpha-locus chemokine) (mILC) (ALP) (Skinkine) (ESkine) (Cutaneous T-cell attracting chemokine) (CTACK) Length = 120 Score = 30.8 bits (68), Expect = 2.8 Identities = 17/43 (39%), Positives = 26/43 (60%) Frame = +3 Query: 246 PSADTILILSSSSKSPEL*VTPLPTSTTCCTIG*SRPSPWQIL 374 P++ L+L S +PE PLP+ST+CCT +P P ++L Sbjct: 7 PASSLPLLLLLLSPAPEA-ALPLPSSTSCCTQLYRQPLPSRLL 48
>SRRM1_CHICK (Q5ZMJ9) Serine/arginine repetitive matrix protein 1| Length = 888 Score = 30.8 bits (68), Expect = 2.8 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +1 Query: 325 PPVVRLGSHGPALGKSWEDGPCTPCRRKLQSSRNPRRAARHQPPPMERTCAEAQ 486 PP+ R S P + P P RR S ++ RR + H PPP +R+ A+ Sbjct: 591 PPIQRRYSPSPPPKRRTASPPPPPKRRASPSPQSKRRVS-HSPPPKQRSSPAAK 643 Score = 29.3 bits (64), Expect = 8.1 Identities = 31/112 (27%), Positives = 38/112 (33%), Gaps = 24/112 (21%) Frame = +1 Query: 247 HQPTPS*SCHRARNRQSCR*HRCLP-PPPVVRLGSHGPALGKSWEDGPCTPCRRK----- 408 H +PS S + + S R R P PPP R S P P P RR Sbjct: 520 HSRSPSPSPRKRQKEPSPRRRRRSPSPPPARRRRSPSPPPPPRRRRSPSLPRRRSPSPPP 579 Query: 409 -------------LQSSRNP-----RRAARHQPPPMERTCAEAQVHQSVSHT 510 +Q +P RR A PPP R Q + VSH+ Sbjct: 580 RRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPQSKRRVSHS 631
>TFR1_CHICK (Q90997) Transferrin receptor protein 1 (TfR1) (TR) (TfR) (Trfr)| Length = 776 Score = 30.4 bits (67), Expect = 3.6 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 4/119 (3%) Frame = -2 Query: 550 KCYNSEHGHKLSLKYGKQTDALVPPHKYVPWVVVDG-EPLYEDYENFEAYV-CKAYKGHP 377 K +N EH KL ++ + + ++G E + E + AY + G P Sbjct: 189 KVWNDEHYIKLQVRGSTKNQVSIS---------INGKEEILETPDAIVAYSESGSVSGKP 239 Query: 376 PKICQGLGRDYPIVQQVVEVGNG--VTYNSGDFELDDKIKMVSADGN**IVCLLSELLY 206 + GL +D+ I+Q+VV NG V +G L +K+ G ++ + L+Y Sbjct: 240 VYVNYGLKKDFEIIQKVVASLNGTIVIVRAGKITLAEKVANAKEAGAAGVLMYVDSLMY 298
>MT36_OCEIH (Q8EL95) Putative modification methylase OB3336 (EC 2.1.1.37)| (Cytosine-specific methyltransferase) (M.OihORF3336P) Length = 460 Score = 30.0 bits (66), Expect = 4.8 Identities = 27/92 (29%), Positives = 39/92 (42%), Gaps = 9/92 (9%) Frame = -2 Query: 511 KYGKQTDALVPPHKYVPWVVVDGE--------PLY-EDYENFEAYVCKAYKGHPPKICQG 359 KY KQ + +P WV V P+Y + Y+N++ + K YK P Q Sbjct: 235 KYYKQPN--IPDETLSDWVTVGDAIGDLPNLFPVYNQKYKNYKPMMMKEYKSPPQNTFQK 292 Query: 358 LGRDYPIVQQVVEVGNGVTYNSGDFELDDKIK 263 L R V +V GN DF + DK++ Sbjct: 293 LMRINNKVDKV--TGNMFRNTKRDFSIFDKME 322
>WIRE_HUMAN (Q8TF74) WIP-related protein (WASP-interacting protein-related| protein) (WIP-and CR16-homologous protein) Length = 440 Score = 29.6 bits (65), Expect = 6.2 Identities = 19/53 (35%), Positives = 23/53 (43%) Frame = +1 Query: 319 PPPPVVRLGSHGPALGKSWEDGPCTPCRRKLQSSRNPRRAARHQPPPMERTCA 477 PPPPV+R G+ D P P ++ S P R PPP RT A Sbjct: 327 PPPPVIRNGA---------RDAPPPPPPYRMHGSEPPSRG--KPPPPPSRTPA 368
>EMAL1_HUMAN (O00423) Echinoderm microtubule-associated protein-like 1 (EMAP-1)| (HuEMAP-1) Length = 717 Score = 29.3 bits (64), Expect = 8.1 Identities = 12/36 (33%), Positives = 24/36 (66%) Frame = +3 Query: 171 RKMKLSYVHIYRYRSSERRHTIYQLPSADTILILSS 278 +++KL +V Y YR + R+ +Y LP+ +T+ ++S Sbjct: 121 KRLKLEWV--YGYRGRDCRNNLYLLPTGETVYFIAS 154
>IE63_HHV11 (P10238) Transcriptional regulator IE63 (VMW63) (ICP27)| Length = 512 Score = 29.3 bits (64), Expect = 8.1 Identities = 15/44 (34%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +1 Query: 352 GPALGKSWEDGPCTPCRRKLQSSRNP-------RRAARHQPPPM 462 GP G W DGP P + S P R R PPP+ Sbjct: 175 GPRPGAGWTDGPGAPHGEAWRGSEQPDPPGGQRTRGVRQAPPPL 218
>Y400_MYCPN (P75383) Hypothetical protein MG281 homolog (F11_orf582)| Length = 582 Score = 29.3 bits (64), Expect = 8.1 Identities = 25/84 (29%), Positives = 34/84 (40%), Gaps = 11/84 (13%) Frame = -2 Query: 460 WVVVDGEPLYEDYENFEAYVCKAYKGHPPKICQG-----------LGRDYPIVQQVVEVG 314 + V +G PLY Y N K P+I QG DY I+ + G Sbjct: 232 YYVANGSPLYNVYPNHHFKQIKTIAFDAPRIKQGNTDGINLNLKQRNPDYVIINGL--TG 289 Query: 313 NGVTYNSGDFELDDKIKMVSADGN 242 +G T D EL + +K VS G+ Sbjct: 290 DGSTLK--DLELPESVKKVSIYGD 311
>ATG18_CRYNE (Q5KGQ2) Autophagy-related protein 18| Length = 423 Score = 29.3 bits (64), Expect = 8.1 Identities = 20/81 (24%), Positives = 42/81 (51%), Gaps = 5/81 (6%) Frame = +3 Query: 135 LVPMCISIINLNRKMKL----SYVHIYRYRSSERRHTIYQLPSADTILILSSSSKSPEL* 302 + P + + +NRK + + ++IY + + HTI P+ + + LSSSS+ L Sbjct: 95 IFPTSVLAVKMNRKRLIVVLENEIYIYDISTMKLLHTIETGPNPNAVCALSSSSERSYLA 154 Query: 303 V-TPLPTSTTCCTIG*SRPSP 362 +P+P++++ + P+P Sbjct: 155 YPSPVPSASSTPLSSSAIPAP 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,608,354 Number of Sequences: 219361 Number of extensions: 1828974 Number of successful extensions: 5171 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 4996 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5153 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)