| Clone Name | rbaal29f13 |
|---|---|
| Clone Library Name | barley_pub |
>DPP5_TRIRU (Q9UW98) Dipeptidyl-peptidase 5 precursor (EC 3.4.14.-)| (Dipeptidyl-peptidase V) (DPP V) (DppV) (Allergen Tri r 4) Length = 726 Score = 29.3 bits (64), Expect = 2.6 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 104 MHGGTSRRWYTNWSNKWN 157 +HGG W NWS +WN Sbjct: 474 IHGGPQGSWGDNWSTRWN 491
>ILF3_MOUSE (Q9Z1X4) Interleukin enhancer-binding factor 3| Length = 898 Score = 29.3 bits (64), Expect = 2.6 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 47 HTGDAANLPRETKYGGEKEMHGGTSRRWYTN 139 + GD+ N P K+ G+K +HGG + Y++ Sbjct: 718 YQGDSYNSPVPPKHAGKKPLHGGQQKASYSS 748
>ILF3_RAT (Q9JIL3) Interleukin enhancer-binding factor 3| Length = 897 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 47 HTGDAANLPRETKYGGEKEMHGGTSRRWYTN 139 + GD+ N P K+ G+K +HGG + Y++ Sbjct: 718 YQGDSYNSPVPPKHAGKKPLHGGQQKPSYSS 748
>DPP5_ASPFU (O13479) Dipeptidyl-peptidase 5 precursor (EC 3.4.14.-)| (Dipeptidyl-peptidase V) (DPP V) (DppV) Length = 721 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +2 Query: 65 NLPRETKYGGEKEMHGGTSRRWYTNWSNKWN 157 N + KY +HGG W WS +WN Sbjct: 463 NFDKSKKYPLIFFIHGGPQGNWADGWSTRWN 493
>DPP5_ASPOR (Q9Y8E3) Dipeptidyl-peptidase 5 precursor (EC 3.4.14.-)| (Dipeptidyl-peptidase V) (DPP V) (DppV) (Alanyl dipeptidyl peptidase) Length = 725 Score = 28.5 bits (62), Expect = 4.4 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 104 MHGGTSRRWYTNWSNKWN 157 +HGG W +WS +WN Sbjct: 479 IHGGPQSSWLDSWSTRWN 496
>CSF3R_HUMAN (Q99062) Granulocyte colony-stimulating factor receptor precursor| (G-CSF-R) (CD114 antigen) Length = 836 Score = 28.5 bits (62), Expect = 4.4 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 1 LLLLIRCPHTAAEQGTHWRCCQSSKRNKIW 90 LLLL+ C GT W CC +++N +W Sbjct: 635 LLLLLTCLC-----GTAWLCCSPNRKNPLW 659
>BARX2_MOUSE (O08686) Homeobox protein BarH-like 2| Length = 228 Score = 28.1 bits (61), Expect = 5.7 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%) Frame = +2 Query: 122 RRWYTNWSNKWNKLF*VLPGEQGIRLKLTLQP---GMTSSQD*EPEANVASEMTPEXLAX 292 + WY N KW K+ VL G Q K +P + +S++ E E + S+ + L Sbjct: 157 KTWYQNRRMKWKKM--VLKGGQEAPTKPKGRPKKNSIPTSEEIEAEEKMNSQAQSQELLE 214 Query: 293 FSERQ 307 SER+ Sbjct: 215 SSERE 219
>MSRAB_VIBCH (Q9KLX6) Peptide methionine sulfoxide reductase msrA/msrB (EC| 1.8.4.6) [Includes: Peptide methionine sulfoxide reductase msrA (Protein-methionine-S-oxide reductase) (Peptide Met(O) reductase); Peptide methionine sulfoxide reductase msrB] Length = 378 Score = 27.7 bits (60), Expect = 7.4 Identities = 16/65 (24%), Positives = 28/65 (43%) Frame = +2 Query: 14 YAAHTLRQNKEHTGDAANLPRETKYGGEKEMHGGTSRRWYTNWSNKWNKLF*VLPGEQGI 193 Y + +R N + + +G ++ H T R+W + + N V P ++ I Sbjct: 184 YKKNKVRYNYYRYASGRDQYLDEIFGADRNTHPKTLRQWIDEKNGQANVKAYVRPSDEQI 243 Query: 194 RLKLT 208 R KLT Sbjct: 244 RAKLT 248
>DPP5_TRISH (Q8J1L4) Dipeptidyl-peptidase 5 precursor (EC 3.4.14.-)| (Dipeptidyl-peptidase V) (DPP V) (DppV) (Allergen Tri s 4) Length = 726 Score = 27.3 bits (59), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 104 MHGGTSRRWYTNWSNKWN 157 +HGG W +WS +WN Sbjct: 474 IHGGPQGSWGDSWSTRWN 491
>DPP5_ARTBE (Q8J1M3) Dipeptidyl-peptidase 5 precursor (EC 3.4.14.-)| (Dipeptidyl-peptidase V) (DPP V) (DppV) (Allergen Tri m 4) Length = 726 Score = 27.3 bits (59), Expect = 9.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 104 MHGGTSRRWYTNWSNKWN 157 +HGG W +WS +WN Sbjct: 474 IHGGPQGSWGDSWSTRWN 491
>COX1_LEITA (P14544) Cytochrome c oxidase subunit 1 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide I) Length = 549 Score = 27.3 bits (59), Expect = 9.7 Identities = 20/77 (25%), Positives = 36/77 (46%) Frame = -3 Query: 284 VFLVSFLMLHLPLVLSLARMSCQVVGLILTGYLALLGVLKTIYSIYCSN*YTTFGWCPHA 105 +F SF++ + L+ SL C + + L L V ++S+YC ++T W P Sbjct: 450 LFWSSFMLYGMLLLASLILFLCALFCVFLFWDYCLFFVSLFVFSLYCFFYFST--WLPCV 507 Query: 104 FLFPHHILFLLEDWQHL 54 + + LL D+ H+ Sbjct: 508 MV----LYLLLVDFAHI 520 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,648,026 Number of Sequences: 219361 Number of extensions: 879259 Number of successful extensions: 2263 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2233 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2262 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)