| Clone Name | rbaal29f08 |
|---|---|
| Clone Library Name | barley_pub |
>GYRB_VIBPA (O51859) DNA gyrase subunit B (EC 5.99.1.3)| Length = 805 Score = 30.0 bits (66), Expect = 6.7 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = -2 Query: 624 YVKQQAARNQEDGAGPVKQGSMHVRVPTPDLEEAKIMETIQSELHSLKGGDGISRSFNRI 445 Y+K + A NQ + + S+HV P L + + +Q +K D +SR + R Sbjct: 546 YIKDEEAMNQYQVSLALDNASLHVNAEAPALAGEALEKLVQQYNAGIKLADRMSRRYPRA 605 Query: 444 TI 439 + Sbjct: 606 LV 607
>TRPV1_MOUSE (Q704Y3) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 839 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_HUMAN (Q8NER1) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Capsaicin receptor) Length = 839 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_CAVPO (Q6R5A3) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 839 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 395 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 427
>TRPV1_CANFA (Q697L1) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 840 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 394 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 426
>TRPV1_RAT (O35433) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) (Vanilloid receptor type 1-like) (Capsaicin receptor) Length = 838 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 393 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 425
>TRPV1_RABIT (Q6RX08) Transient receptor potential cation channel subfamily V| member 1 (TrpV1) (osm-9-like TRP channel 1) (OTRPC1) (Vanilloid receptor 1) Length = 842 Score = 30.0 bits (66), Expect = 6.7 Identities = 13/33 (39%), Positives = 23/33 (69%) Frame = +1 Query: 205 NSVIRIRCFTTAATTSSTDMILVEPCSQRLQCK 303 NSV+ + ++++ T + DM+LVEP ++ LQ K Sbjct: 396 NSVLEVIAYSSSETPNRHDMLLVEPLNRLLQDK 428
>PLEC1_CRIGR (Q9JI55) Plectin-1 (PLTN) (PCN) (300-kDa intermediate| filament-associated protein) (IFAP300) (Fragment) Length = 4473 Score = 29.6 bits (65), Expect = 8.7 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%) Frame = -2 Query: 642 HQQLYNY-VKQQAARNQEDGAGPVKQGSMHVRVPTPDLEEAKIMETIQSELHSLKGGDG 469 HQ + + K + ARN E P +G+ + DL+ AK++ + ++ L SL+ G Sbjct: 488 HQSIEEFRAKIERARNDESQLSPATRGAYRECLGRLDLQYAKLLNSSKARLRSLESLHG 546 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,203,467 Number of Sequences: 219361 Number of extensions: 1657462 Number of successful extensions: 4597 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 4492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4597 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)