| Clone Name | rbaal29f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NPAS1_HUMAN (Q99742) Neuronal PAS domain protein 1 (Neuronal PAS... | 32 | 2.2 | 2 | TSC1_RAT (Q9Z136) Hamartin (Tuberous sclerosis 1 protein homolog) | 30 | 4.9 | 3 | SOML2_SPAAU (P79894) Somatolactin-2 precursor (SL) | 30 | 8.3 | 4 | SOML1_SPAAU (P54863) Somatolactin-1 precursor (SL) | 30 | 8.3 | 5 | SNPC4_HUMAN (Q5SXM2) snRNA-activating protein complex subunit 4 ... | 30 | 8.3 |
|---|
>NPAS1_HUMAN (Q99742) Neuronal PAS domain protein 1 (Neuronal PAS1) (Member of| PAS protein 5) (MOP5) Length = 590 Score = 31.6 bits (70), Expect = 2.2 Identities = 21/63 (33%), Positives = 27/63 (42%) Frame = -3 Query: 483 WTQALQPAQGQGHRAALPGDHRVLQDHRR*PQAEAGLDPPRQEERREARIPCLTSQSPLP 304 W Q++ G G PG+H VL QAE G P + A + C + SP P Sbjct: 379 WLQSVATVAGSGKS---PGEHHVLWVSHVLSQAEGG-QTPLDAFQLPASVACEEASSPGP 434 Query: 303 SPT 295 PT Sbjct: 435 EPT 437
>TSC1_RAT (Q9Z136) Hamartin (Tuberous sclerosis 1 protein homolog)| Length = 1163 Score = 30.4 bits (67), Expect = 4.9 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = -3 Query: 393 PQAEAGLDPPRQEERREARIPCLTSQSPLPS 301 P ++A PPR+EER ++ P L Q +PS Sbjct: 410 PASQASATPPRKEERADSSRPYLPRQQDVPS 440
>SOML2_SPAAU (P79894) Somatolactin-2 precursor (SL)| Length = 231 Score = 29.6 bits (65), Expect = 8.3 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -3 Query: 366 PRQEERREARIPCLTSQSPLPSPTLFY*Q---KAIINLPFLLAKGSHQPLFYLSLEL 205 P Q +R +A PC+T P+PS Q K +++ +L + +PL YL L Sbjct: 77 PLQLQRNQAGYPCITKALPIPSSKSEIQQISDKWLLHSVLMLVQSWIEPLVYLQTTL 133
>SOML1_SPAAU (P54863) Somatolactin-1 precursor (SL)| Length = 231 Score = 29.6 bits (65), Expect = 8.3 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 3/57 (5%) Frame = -3 Query: 366 PRQEERREARIPCLTSQSPLPSPTLFY*Q---KAIINLPFLLAKGSHQPLFYLSLEL 205 P Q +R +A PC+T P+PS Q K +++ +L + +PL YL L Sbjct: 77 PLQLQRNQAGYPCITKALPIPSSKSEIQQISDKWLLHSVLMLVQSWIEPLVYLQTTL 133
>SNPC4_HUMAN (Q5SXM2) snRNA-activating protein complex subunit 4 (SNAPc subunit 4)| (snRNA-activating protein complex 190 kDa subunit) (SNAPc 190 kDa subunit) (Proximal sequence element-binding transcription factor alpha subunit) (PSE-binding factor alpha Length = 1469 Score = 29.6 bits (65), Expect = 8.3 Identities = 16/56 (28%), Positives = 25/56 (44%) Frame = -3 Query: 465 PAQGQGHRAALPGDHRVLQDHRR*PQAEAGLDPPRQEERREARIPCLTSQSPLPSP 298 PA+ G A +PG+ +V ++ P+ + DPP E R+P P P Sbjct: 1164 PAEADGSVAFVPGEAQVAREIPE-PRTSSHADPPEAEPPWSGRLPAFGGVIPATEP 1218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,546,961 Number of Sequences: 219361 Number of extensions: 1451540 Number of successful extensions: 3998 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3878 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3995 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)