| Clone Name | rbaal28k10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 pre... | 29 | 2.8 | 2 | NU5H_NYCOV (Q5DUY0) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 28 | 4.8 | 3 | YM8M_YEAST (Q03263) Hypothetical transport protein YMR279C | 28 | 6.2 |
|---|
>GP158_MOUSE (Q8C419) Probable G-protein coupled receptor 158 precursor| Length = 1200 Score = 29.3 bits (64), Expect = 2.8 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -3 Query: 159 GWIVILESAFYSLCKNILPVLAGL 88 GW+V L +AFY L N++P G+ Sbjct: 280 GWLVTLSAAFYGLQPNLVPEFRGV 303
>NU5H_NYCOV (Q5DUY0) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 1849 Score = 28.5 bits (62), Expect = 4.8 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = -3 Query: 189 RHHVLHRFGIGWIVILESAFYSLCKN-ILPVLAGLQADWPRLELHVTVYGDL 37 R L+RFG W+ YSLC N LP L L P + ++++ G+L Sbjct: 1387 RTFALNRFGDLWMFTASIEIYSLCHNDALPTLFAL---LPYAQFNLSILGNL 1435
>YM8M_YEAST (Q03263) Hypothetical transport protein YMR279C| Length = 540 Score = 28.1 bits (61), Expect = 6.2 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = -3 Query: 180 VLHRFGIGWIVILESAFYSLCKNILPVLAGLQADW 76 V + FGI + L A+YS+ N+ + GL DW Sbjct: 234 VFYAFGIATFLSLLMAWYSIPNNVPTNIHGLSMDW 268 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,341,832 Number of Sequences: 219361 Number of extensions: 698686 Number of successful extensions: 1328 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1328 length of database: 80,573,946 effective HSP length: 60 effective length of database: 67,412,286 effective search space used: 1617894864 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)